powered by:
Protein Alignment gzl and AT3G30460
DIOPT Version :9
Sequence 1: | NP_001097695.1 |
Gene: | gzl / 40791 |
FlyBaseID: | FBgn0037442 |
Length: | 536 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_189667.2 |
Gene: | AT3G30460 / 822758 |
AraportID: | AT3G30460 |
Length: | 183 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 37/66 - (56%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 216 KKLPVLRYTKNNANNK-YDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRK 279
::|||:.:|......: ...|.||.|:...:::|..|||.|.||..||..||: ||..||:|:..
plant 113 EELPVVEFTAEEMMERGLVVCAICREELAANERLSELPCRHYYHKECISNWLS-NRNTCPLCRHN 176
Fly 280 V 280
|
plant 177 V 177
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
gzl | NP_001097695.1 |
PA_C_RZF_like |
14..171 |
CDD:239038 |
|
zf-RING_2 |
233..277 |
CDD:290367 |
19/43 (44%) |
AT3G30460 | NP_189667.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.