DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and AT3G30460

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_189667.2 Gene:AT3G30460 / 822758 AraportID:AT3G30460 Length:183 Species:Arabidopsis thaliana


Alignment Length:66 Identity:25/66 - (37%)
Similarity:37/66 - (56%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 KKLPVLRYTKNNANNK-YDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRK 279
            ::|||:.:|......: ...|.||.|:...:::|..|||.|.||..||..||: ||..||:|:..
plant   113 EELPVVEFTAEEMMERGLVVCAICREELAANERLSELPCRHYYHKECISNWLS-NRNTCPLCRHN 176

  Fly   280 V 280
            |
plant   177 V 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 19/43 (44%)
AT3G30460NP_189667.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.