DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and AT3G13430

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001030687.1 Gene:AT3G13430 / 820543 AraportID:AT3G13430 Length:315 Species:Arabidopsis thaliana


Alignment Length:139 Identity:38/139 - (27%)
Similarity:58/139 - (41%) Gaps:40/139 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 RYTKNNANNKYDT----------------------CVICLEDFIEDDKLRVLPCSHPYHTHCIDP 264
            |..:|:.||:|.|                      |.:||:||....:.:.:||.|.:|:.|:.|
plant   190 RLAENDLNNRYGTPPATKEAVEALAMVKIEDSLLQCSVCLDDFEIGMEAKEMPCKHKFHSDCLLP 254

  Fly   265 WLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSASSA 329
            || |....||:| |.:...|:     ..:|..|..|..:||          |...:...|.||: 
plant   255 WL-ELHSSCPVC-RYLLPTGD-----DDEPKTDAETSRNDD----------NNEDISNASMASN- 301

  Fly   330 GGAAGSSSS 338
            |.:..|||:
plant   302 GSSPDSSSN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 17/65 (26%)
AT3G13430NP_001030687.1 zinc_ribbon_9 7..40 CDD:405118
RING-H2_RNF126_like 224..266 CDD:319581 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.