DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and rnf149

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_012812754.1 Gene:rnf149 / 780151 XenbaseID:XB-GENE-972101 Length:398 Species:Xenopus tropicalis


Alignment Length:356 Identity:83/356 - (23%)
Similarity:140/356 - (39%) Gaps:105/356 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QFGPNLPSNGLKVYVVPARRPYY--GCDSLDRPPHLKY---------PPSAKFVALVARGECVFE 101
            ::|.:.|.:.::..|...|.|:.  ||.     |..:|         .|.:.::||:|||.|.|:
 Frog    51 RYGDSSPKDTVQGLVGYPRDPWQLEGCH-----PDTQYIVPGMPASPAPDSDWIALIARGGCTFK 110

  Fly   102 RKIRVAQNASYSAVIVYN--NEGD------DLEQMSAENITGIRIPSVFVGHTTGKALATYFTTE 158
            .|:..|.|...|||::||  ..|:      .||.|.....||..: .:.|.:..|        .|
 Frog   111 EKVFNAANRGASAVVIYNEAKSGNATVSMSHLESMDTSEGTGNTV-VIMVSYPKG--------ME 166

  Fly   159 VVLIINDELP----FNINTQLILPF-----SILIGMCFIIMVI----YMIY-----------KCI 199
            ::..:..::|    ..:.|:.:..|     .:.:.:.||.|:|    ::|:           :|.
 Frog   167 ILEPMRRDIPVKMVITMGTRHVQEFISGQSVVFVAIAFITMMIISLAWLIFYYIQRFLYTGAQCG 231

  Fly   200 REQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYD--TCVICLEDFIEDDKLRVLPCSHPYHTHCI 262
            .:..|    :..|..:.:|.:.|..|.......|  .|.:|:|::...|.:|:|||.|.:|..||
 Frog   232 NQSNR----KETKKAISQLQLHRVKKGEKGIDIDAENCAVCIENYKTKDLVRILPCKHIFHRLCI 292

  Fly   263 DPWLTENRRVCPICKRKV---------------------------------FTKGEARASRSRQP 294
            ||||.|: |.||:||..|                                 .|:.|:|:..:..|
 Frog   293 DPWLIEH-RTCPMCKLDVIKALGFWVEPEETVDIHVPVSIAGSSLSIGTVSITQEESRSEGNNLP 356

  Fly   295 SLDNVTDTDDDTTPLLQQQQSNGRQVGQVSS 325
            |        ..|...|||..|.....|:.::
 Frog   357 S--------SSTGSSLQQSNSVKEDAGETTA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 35/145 (24%)
zf-RING_2 233..277 CDD:290367 21/45 (47%)
rnf149XP_012812754.1 PA_GRAIL_like 34..181 CDD:239037 35/143 (24%)
UPF0233 <200..>220 CDD:299753 5/19 (26%)
zf-RING_2 263..306 CDD:290367 20/43 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.