DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rnf148

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_082030.1 Gene:Rnf148 / 71300 MGIID:1918550 Length:316 Species:Mus musculus


Alignment Length:275 Identity:71/275 - (25%)
Similarity:117/275 - (42%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HVLVYRKATSQLIEEFNDLPAQFGPNLPSNGLK-VYVVPARRPYYGCDSL---DRPPHLKYPPSA 87
            |:.:..:..:::|.|..: ...||.:.|...:. ..|:|.......|..|   .||..     :.
Mouse    54 HLNITFQVGNRIISELGE-SGVFGNHSPLERVSGAVVLPEGWNQNACSPLTNFSRPDQ-----TD 112

  Fly    88 KFVALVARGECVFERKIRVAQNASYSAVIVYNNEGD-----DLEQMSAENITGIRIPSVFVGHTT 147
            .::||:.||.|.|..||.:|.....:.||:||..|.     .:.....|||.     :|.:|:..
Mouse   113 TWLALIERGGCTFTHKINLAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIV-----AVMIGNLK 172

  Fly   148 GKAL-----ATYFTTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQR---- 203
            |..|     ...:.|.::.:....:|: ::..::..|:.|..     .|.|:...|....|    
Mouse   173 GMELLHLIQQGVYVTIIIEVGRMHMPW-LSHYVMSLFTFLAA-----TVTYLFLYCAWRPRVSNS 231

  Fly   204 RLRRHRLPKSMLKK------LPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCI 262
            ..||.|..|:.:||      |.||:......:...|:||:|.:.:...|.:|:|.|.|.:|..||
Mouse   232 STRRQRQLKADVKKAIGQLQLRVLQDGDKELDPNEDSCVVCFDMYKAQDVIRILTCKHFFHKTCI 296

  Fly   263 DPWLTENRRVCPICK 277
            ||||..: |.||:||
Mouse   297 DPWLLAH-RTCPMCK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 35/157 (22%)
zf-RING_2 233..277 CDD:290367 19/43 (44%)
Rnf148NP_082030.1 PA_GRAIL_like 56..190 CDD:239037 33/144 (23%)
zf-RING_2 267..310 CDD:290367 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.