DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rnf13

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001102914.1 Gene:Rnf13 / 681578 RGDID:1594062 Length:380 Species:Rattus norvegicus


Alignment Length:375 Identity:136/375 - (36%)
Similarity:202/375 - (53%) Gaps:51/375 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QILTLLGLCLVCHEATL-VGGHVLVYRKATSQLIEEFNDLPAQFGPNLPSNGLKVYVVPARRPYY 70
            |:.|:|.:.|......| |...:|.|....:.  :.|.||||:||..||:.|||.:::.: :|..
  Rat    14 QVYTILTVQLFAFLNLLPVEADILAYNFENAS--QTFEDLPARFGYRLPAEGLKGFLINS-KPEN 75

  Fly    71 GCDSLDRPPHLKYPPSAKFVALVARGECVFERKIRVAQNASYSAVIVYNNEGDDLEQMSAENI-- 133
            .|:.: .||.||...|..|:.|:.|.:|.|:.|:..||.|.|.|.||:|.:.|||..|.:.:|  
  Rat    76 ACEPI-VPPPLKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIDI 139

  Fly   134 -TGIRIPSVFVGHTTGKALATYFTTE----VVLIINDELPFNINTQLILPFSILIGMCFIIMVIY 193
             ..|.|||||:|.::..:|...||.|    |:|:....||..   ..::||.|::|:|.|::||:
  Rat   140 LKKIDIPSVFIGESSANSLKDEFTYEKGGHVILVPELSLPLE---YYLIPFLIIVGICLILIVIF 201

  Fly   194 MIYKCIREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYH 258
            ||.|.::::.|.||:||.|..||||||.::.|   .::||.|.||||::.:.||||:|||||.||
  Rat   202 MITKFVQDRHRNRRNRLRKDQLKKLPVHKFKK---GDEYDVCAICLEEYEDGDKLRILPCSHAYH 263

  Fly   259 THCIDPWLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQV 323
            ..|:|||||:.::.||:||:||.            ||..   |:|.||.   ..|:.|     ||
  Rat   264 CKCVDPWLTKTKKTCPVCKQKVV------------PSQG---DSDSDTD---SSQEEN-----QV 305

  Fly   324 SSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDEN 373
            |.         .:..:..:|.|.|...|:....|: .:..|.|...||:|
  Rat   306 SE---------HTPLLPPSASARTQSFGSLSESHS-HHMTESSDYEDDDN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 58/164 (35%)
zf-RING_2 233..277 CDD:290367 25/43 (58%)
Rnf13NP_001102914.1 PA_C_RZF_like 23..180 CDD:239038 57/160 (36%)
RING-H2_RNF167 238..283 CDD:319711 26/44 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..380 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8729
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3584
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm45328
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.