DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rnf148

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001178011.1 Gene:Rnf148 / 681407 RGDID:1595417 Length:316 Species:Rattus norvegicus


Alignment Length:275 Identity:73/275 - (26%)
Similarity:117/275 - (42%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HVLVYRKATSQLIEEFNDLPAQFGPNLPSNGLK-VYVVPARRPYYGCDSL---DRPPHLKYPPSA 87
            |:.:..:..:::|.|..: ...||.:.|...:. ..|:|.......|..|   .||..     :.
  Rat    54 HLNITFQVGNRIISELGE-SGVFGNHSPLERVSGAVVLPEGWNQNACSPLTNFSRPDQ-----AD 112

  Fly    88 KFVALVARGECVFERKIRVAQNASYSAVIVYNNEGD-----DLEQMSAENITGIRIPSVFVGHTT 147
            .::||:.||.|.|..||.||.....:.||:||..|.     .:.....|||.     :|.:|:..
  Rat   113 SWLALIERGGCTFTHKINVAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIV-----AVMIGNLK 172

  Fly   148 GKAL-----ATYFTTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQR---- 203
            |..|     ...:.|.::.:....:|: ::..::..|:.|..     .|.|:...|....|    
  Rat   173 GMELLHLIQQGVYVTIIIEVGRMHMPW-LSHYVMSLFTFLAA-----TVAYLFLYCAWRPRAPNS 231

  Fly   204 RLRRHRLPKSMLKK------LPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCI 262
            ..||.|..||.:||      |.||:......:...|:||:|.:.:...|.:|:|.|.|.:|..||
  Rat   232 STRRQRQIKSDVKKAIGQLQLRVLKEGDKELDPNEDSCVVCFDIYKAQDVIRILTCKHFFHKTCI 296

  Fly   263 DPWLTENRRVCPICK 277
            ||||..: |.||:||
  Rat   297 DPWLLAH-RTCPMCK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 36/157 (23%)
zf-RING_2 233..277 CDD:290367 19/43 (44%)
Rnf148NP_001178011.1 PA_GRAIL_like 56..190 CDD:239037 34/144 (24%)
zf-RING_2 267..310 CDD:290367 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.