powered by:
Protein Alignment gzl and RNF6
DIOPT Version :9
Sequence 1: | NP_001097695.1 |
Gene: | gzl / 40791 |
FlyBaseID: | FBgn0037442 |
Length: | 536 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005968.1 |
Gene: | RNF6 / 6049 |
HGNCID: | 10069 |
Length: | 685 |
Species: | Homo sapiens |
Alignment Length: | 114 |
Identity: | 35/114 - (30%) |
Similarity: | 55/114 - (48%) |
Gaps: | 35/114 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 EQRRLRRHRLPKSMLK--KLPVLRY---------------------------TKNNANNKYDT-- 234
:.|..|:.|.|.:::: .||:||. |::..:|..|:
Human 564 DSRGGRQLRNPNNLVETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSEL 628
Fly 235 ---CVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKV 280
|.:|:.|::..:|||.|||.|.:|.||||.||:|| ..||||::.|
Human 629 GKICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSEN-CTCPICRQPV 676
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1487241at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.