DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment gzl and RNF6

DIOPT Version :9

Sequence 1:	NP_001097695.1	Gene:	gzl / 40791	FlyBaseID:	FBgn0037442	Length:	536	Species:	Drosophila melanogaster
Sequence 2:	NP_005968.1	Gene:	RNF6 / 6049	HGNCID:	10069	Length:	685	Species:	Homo sapiens

Alignment Length:	114	Identity:	35/114 - (30%)
Similarity:	55/114 - (48%)	Gaps:	35/114 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   201 EQRRLRRHRLPKSMLK--KLPVLRY---------------------------TKNNANNKYDT-- 234
            :.|..|:.|.|.::::  .||:||.                           |::..:|..|:
Human   564 DSRGGRQLRNPNNLVETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSEL 628

  Fly   235 ---CVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKV 280
               |.:|:.|::..:|||.|||.|.:|.||||.||:|| ..||||::.|
Human   629 GKICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSEN-CTCPICRQPV 676

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
gzl	NP_001097695.1	PA_C_RZF_like	14..171	CDD:239038
gzl	NP_001097695.1	zf-RING_2	233..277	CDD:290367	23/48 (48%)
RNF6	NP_005968.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..29
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	81..107
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	121..142
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	168..273
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	286..345
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	499..576		4/11 (36%)
		Required for polyubiquitination. /evidence=ECO:0000250	607..685		27/71 (38%)
		RING-H2_RNF6	630..674	CDD:319587	23/44 (52%)
		RING-H2 finger (C3H2C3-type)	632..672	CDD:319587	21/40 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1487241at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.920