DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and RNF150

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_005263207.1 Gene:RNF150 / 57484 HGNCID:23138 Length:460 Species:Homo sapiens


Alignment Length:332 Identity:83/332 - (25%)
Similarity:139/332 - (41%) Gaps:79/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QFGPNLPSNGLKVYVVPARRPYYGCDSLDRPPHLKY--PPSAK-FVALVARGECVFERKIRVA-- 107
            ::|.:.|....:..||.|...:   |.|...|:.|:  |...| ::||:.:|.|.:..|||.|  
Human    76 RYGEHSPKQDARGEVVMASSAH---DRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKIRNAFL 137

  Fly   108 QNASYSAVIVYN-----NE-------------GDDLEQMS---------AENITGIRIPSVFVGH 145
            |||  |||:::|     ||             ...|:.:|         .|:|..|.||     .
Human   138 QNA--SAVVIFNVGSNTNETITMPHAGLMSSHAQPLKLISPCPYSLSSGVEDIVAIMIP-----E 195

  Fly   146 TTGKALATY----FTTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVI----YMIYKCI--- 199
            ..||.:.:.    .|..:.:.|...   |:...:.....:.:.:.||:::|    ::::..|   
Human   196 PKGKEIVSLLERNITVTMYITIGTR---NLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRF 257

  Fly   200 -------REQRRLRRHRLPKSMLKKLPVLRYTKNN--ANNKYDTCVICLEDFIEDDKLRVLPCSH 255
                   |.||||  ....|..:.||.:....|.:  ..:.:|.|.:|:|.:..:|.:|:|||.|
Human   258 RYANARDRNQRRL--GDAAKKAISKLQIRTIKKGDKETESDFDNCAVCIEGYKPNDVVRILPCRH 320

  Fly   256 PYHTHCIDPWLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQV 320
            .:|..|:||||.:: |.||:||..:.      .:....|:.|.:.|...|....|     .|...
Human   321 LFHKSCVDPWLLDH-RTCPMCKMNIL------KALGIPPNADCMDDLPTDFEGSL-----GGPPT 373

  Fly   321 GQVSSAS 327
            .|::.||
Human   374 NQITGAS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 39/158 (25%)
zf-RING_2 233..277 CDD:290367 19/43 (44%)
RNF150XP_005263207.1 PA_GRAIL_like 45..215 CDD:239037 38/148 (26%)
UPF0233 <229..>254 CDD:299753 3/24 (13%)
zf-RING_2 298..341 CDD:290367 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.