DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and rlim

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_009306042.1 Gene:rlim / 562487 ZFINID:ZDB-GENE-120809-2 Length:638 Species:Danio rerio


Alignment Length:113 Identity:39/113 - (34%)
Similarity:61/113 - (53%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKY 232
            |.|::....||| :.:...|:          :.|:...:...|.|..:..|.:..:.:::|   :
Zfish   531 PINLDETGSLPF-LRLAHFFL----------LNEEDDDQPRGLTKEQIDNLSMRNFGESDA---F 581

  Fly   233 DTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKV 280
            .||.:|:.::.|.:|||.|||||.||.||||.||:|| ..||||:|.|
Zfish   582 KTCSVCITEYAEGNKLRKLPCSHEYHVHCIDRWLSEN-STCPICRRAV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 1/2 (50%)
zf-RING_2 233..277 CDD:290367 25/43 (58%)
rlimXP_009306042.1 zf-RING_2 583..625 CDD:290367 25/42 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.