DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and chmp3

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_002937319.1 Gene:chmp3 / 548983 XenbaseID:XB-GENE-1005141 Length:681 Species:Xenopus tropicalis


Alignment Length:114 Identity:35/114 - (30%)
Similarity:49/114 - (42%) Gaps:27/114 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 KCIREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDT----------CVICLEDFIEDDKLRVL 251
            ||...:|:.|.....|.          |||:....:.:          ||:|||:|.....|..|
 Frog   580 KCSPTERKTRSPYGSKC----------TKNDMEPNWASWPGNMLHCTECVVCLENFENGSLLMGL 634

  Fly   252 PCSHPYHTHCIDPWLTENRRVCPIC-----KRKVFTKGEARASRSRQPS 295
            ||.|.:|.:||..||...|..||:|     |:|.|.:  .::|.|..||
 Frog   635 PCGHVFHQNCIVMWLAGGRHCCPVCRWASYKKKHFAR--PQSSTSHPPS 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 20/58 (34%)
chmp3XP_002937319.1 RING-H2_RNF103 617..661 CDD:319387 20/43 (47%)
RING-H2 finger (C3H2C3-type) 618..659 CDD:319387 19/40 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.