DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and rnf181

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001011200.1 Gene:rnf181 / 496625 XenbaseID:XB-GENE-964051 Length:156 Species:Xenopus tropicalis


Alignment Length:105 Identity:32/105 - (30%)
Similarity:53/105 - (50%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RLP----KSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTEN 269
            |||    |.:::.||.:..|...|:... .|.:||.:|.|.:.:|.|||.|.:|:.||.|||.:.
 Frog    50 RLPPPAAKKVVESLPKVTVTPEQADAAL-KCPVCLLEFEEGETVRQLPCEHLFHSSCILPWLGKT 113

  Fly   270 RRVCPICKRKVFT--------KGEARASRSRQPSLDNVTD 301
            .. ||:|:.::.|        |.|....:.::..|:.:.|
 Frog   114 NS-CPLCRHELPTDSPEYEEYKQEKERRQQKEHRLECLHD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 18/43 (42%)
rnf181NP_001011200.1 PEX10 <10..126 CDD:227861 27/77 (35%)
RING-H2_RNF181 78..123 CDD:319583 19/45 (42%)
RING-H2 finger (C3H2C3-type) 79..119 CDD:319583 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.