DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and RNF165

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_689683.2 Gene:RNF165 / 494470 HGNCID:31696 Length:346 Species:Homo sapiens


Alignment Length:85 Identity:27/85 - (31%)
Similarity:42/85 - (49%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDT---CVICLEDFIEDDKLRVLPCSHPYHTHCID 263
            |..:.|...|....|:.|.....|.:...:.||   |.|||....:.:.:|.|||.|.:|..|:|
Human   258 QNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVD 322

  Fly   264 PWLTENRRVCPICKRKVFTK 283
            .||..::: ||||:..:.|:
Human   323 QWLAMSKK-CPICRVDIETQ 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 19/46 (41%)
RNF165NP_689683.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..76
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 266..268 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..288 4/20 (20%)
RING-H2_RNF111_like 292..337 CDD:319388 18/45 (40%)
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 309..313 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.