DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and rnf13

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:380 Identity:130/380 - (34%)
Similarity:196/380 - (51%) Gaps:49/380 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKRSCQILTLLGLCLVCHEATLVGGHVLVYRKATSQLIEEFNDLPAQFGPNLPSNGLKVYVVPA 65
            :.|..|.:|.... ||.......|...|..|  ....:...|:||||:||..|||:|||.|:|.|
 Frog    10 LMKPFCNLLAFCS-CLAVIHLVPVQADVAAY--TADNVSRTFDDLPARFGYRLPSDGLKGYIVTA 71

  Fly    66 RRPYYGCDSLDRPPHLKYPPSAKFVALVARGECVFERKIRVAQNASYSAVIVYNNEGDDLEQMSA 130
             :|...|..:..||.|:...|:.|:.|:.|.||.|:.|:..||.|.:.|.:|||.:.|||..|.:
 Frog    72 -KPENACQPISPPPLLRDNTSSVFIVLIKRLECNFDLKVLNAQKAGFKAAVVYNVDSDDLISMGS 135

  Fly   131 ENI---TGIRIPSVFVGHTTGKALATYFTTE----VVLIINDELPFNINTQLILPFSILIGMCFI 188
            .::   ..|.|||||:|.::.:.|...|:.|    :||:.:..||..   ..::||.|::|:|.:
 Frog   136 NDVDILKQIDIPSVFIGESSARFLKEEFSWEKGGYIVLVPDLTLPLE---YYLIPFLIIVGICLV 197

  Fly   189 IMVIYMIYKCIREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPC 253
            ::||:||.|.::::.|.||:||.|..|||||:.::.|   .::||.|.:||:::.|.||||:|||
 Frog   198 LIVIFMITKFVQDRHRARRNRLRKDQLKKLPIHKFKK---GDEYDVCAVCLDEYEEGDKLRILPC 259

  Fly   254 SHPYHTHCIDPWLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGR 318
            ||.||..|:|||||:.::.||:||:||........|.|.....||..   .:.||||:...|   
 Frog   260 SHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSESDSDSSQEDNEV---SENTPLLRPMAS--- 318

  Fly   319 QVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDEN 373
                                      |.|...|.....|:.:|..|.|...:|::
 Frog   319 --------------------------ASTQSFGAISESHSQQNMMESSGEDEDDD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 59/163 (36%)
zf-RING_2 233..277 CDD:290367 24/43 (56%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038 57/159 (36%)
RING_Ubox 239..284 CDD:388418 25/44 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8948
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3439
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm48402
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.