DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and CG7694

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster


Alignment Length:111 Identity:30/111 - (27%)
Similarity:48/111 - (43%) Gaps:25/111 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 KSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPIC 276
            |..:.:|||....|::.....: |.:|.|...|..|.|:|||.|.:|..||..||.:... ||:|
  Fly    48 KRAILELPVHEIVKSDEGGDLE-CSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNS-CPLC 110

  Fly   277 KRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLL---QQQQSNGRQ 319
            :.::                    :|||.....|   :|.::|.|:
  Fly   111 RYEL--------------------ETDDPVYEELRRFRQDEANRRE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 17/43 (40%)
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.