DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rnf133

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_937894.1 Gene:Rnf133 / 386611 MGIID:2677436 Length:339 Species:Mus musculus


Alignment Length:327 Identity:83/327 - (25%)
Similarity:124/327 - (37%) Gaps:87/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VYVVPARRPYYGCDSLDRP------PHLKYPPSAKFVALVARGECVFERKIRVAQNASYSAVIVY 118
            |.|.|..:....||    |      |..|.|    ::||:.||.|.|.:||:||.......||:|
Mouse    74 VVVPPEGKIQNACD----PNTTFILPRNKEP----WIALIERGGCAFTQKIKVASEHGARGVIIY 130

  Fly   119 N--NEGDDLEQMSAENITGIRIPSVFVGHTTGKALATYFTTEVVLIINDELPFNINTQLILPFSI 181
            |  ..|:.:..||.:....|.:  |.:|:     :..|||                         
Mouse   131 NFPGTGNQVFPMSHQAFEDIVV--VMIGN-----IKAYFT------------------------- 163

  Fly   182 LIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSMLK-----KLPVLRYTKNNANNKYDTCVICLED 241
                   ...|..::....|.||.:  ||.:.:.|     ::.||:......|...|:||||.|.
Mouse   164 -------FYHIRRLWVARIENRRWK--RLTRELKKAFGQLQVRVLKEGDEEVNPNADSCVICFEA 219

  Fly   242 FIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDT 306
            :..::.:|:|.|.|.:|.:|||||:..: ..||:||..:.            .:|....|.:|.|
Mouse   220 YKPNEIVRILTCKHFFHKNCIDPWILAH-GTCPMCKCDIL------------KALGIQMDIEDGT 271

  Fly   307 TPLLQQQQSNGRQVGQVSSASSAGG----AAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQ 367
            .. ||...|| ...|.:|.......    .|.:||.     |.....|.| ...:||..|.|..:
Mouse   272 DS-LQVLMSN-ELPGTLSPVEEETNYELPPARTSSK-----VTHVQEHPT-SSANAGSQPPEAEE 328

  Fly   368 SS 369
            :|
Mouse   329 TS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 32/118 (27%)
zf-RING_2 233..277 CDD:290367 18/43 (42%)
Rnf133NP_937894.1 PA_GRAIL_like 43..159 CDD:239037 29/99 (29%)
zf-RING_2 211..254 CDD:290367 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.