DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and gol

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:530 Identity:116/530 - (21%)
Similarity:186/530 - (35%) Gaps:186/530 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EFNDLPAQFGPNLPSNGLKVYVVPARRPY----------YGCDSLDRPPHLK------YPPSAK- 88
            ||....|::|..      ||..|..|..:          |.|     .|:::      .|...: 
  Fly    87 EFAQEQARYGEG------KVLNVTGRLIHITATDNFSDDYAC-----TPYIRGTLGAPIPDKGET 140

  Fly    89 FVALVARGECVFERKIR--VAQNA------------------------SYSAVIVYNNEGDDLEQ 127
            ::|||.||.|.||.|::  ..|||                        :.:|||.|.|.|.||..
  Fly   141 WIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNIGQDLSL 205

  Fly   128 M--SAENITGIRIPSVFVGHTTGKALATYFTTEVVLIINDELPFNINTQLILPFSILIGMCFIIM 190
            .  ...|:|    .|:..|....:.:::...|.|:.:             .:.|.:|:.:..:.:
  Fly   206 TLDKGYNVT----ISIIEGRRGVRTISSLNRTSVLFV-------------SISFIVLMIISLVWL 253

  Fly   191 VIYMI----YKCIREQRRLRRHRLPKSMLKKLPVLRYTKNN--ANNK---YDTCVICLEDFIEDD 246
            :.|.|    |...::|:......:.|..:.|:|    ||..  ::.|   .|.|.||:|.:...|
  Fly   254 IFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIP----TKTGKFSDEKDLDSDCCAICIEAYKPTD 314

  Fly   247 KLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKVF---------------------TKG----EA 286
            .:|:|||.|.:|.:||||||.|: |.||:||..|.                     .:|    ||
  Fly   315 TIRILPCKHEFHKNCIDPWLIEH-RTCPMCKLDVLKFYGYVFLGSEESILEYQPDPPQGLALVEA 378

  Fly   287 R-----ASRSRQPSLD----------------------NVTDTDDDTTPL-------------LQ 311
            |     .:|||...:|                      .:.:....:..|             |:
  Fly   379 RDESADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFPCRIPERSQSSLSLRQARDWVSLMSNKLE 443

  Fly   312 QQQS-----NGRQVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDD 371
            :||.     |.....|:.||..:.....|.|:        ..|:.|...|...|.|         
  Fly   444 EQQGLRSMRNDEMQQQLLSARESARHRRSRSA--------DGRYSTGCFGGRQRQP--------- 491

  Fly   372 ENALLASTVRPATSSGAHERINPFDRAPNLPA--HLAEQL-TESRRSVWSRINFA----SFFRRQ 429
             :.|::|..:|.    .|..:....|:.:..|  ||.:.. .:||:......:||    .|.||:
  Fly   492 -SVLVSSLGQPQ----LHSEVAQMQRSNSSQALKHLTDAAHAQSRQRQRESFDFARTRRRFMRRE 551

  Fly   430 PAVISVAAPP 439
            ...||:.:.|
  Fly   552 SDEISLRSLP 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 38/174 (22%)
zf-RING_2 233..277 CDD:290367 22/43 (51%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 34/144 (24%)
UPF0233 226..>258 CDD:299753 5/44 (11%)
zf-RING_2 301..344 CDD:290367 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.