DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rnf150

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001178022.1 Gene:Rnf150 / 364983 RGDID:1304572 Length:437 Species:Rattus norvegicus


Alignment Length:311 Identity:82/311 - (26%)
Similarity:137/311 - (44%) Gaps:59/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QFGPNLPSNGLKVYVVPARRPYYGCDSLDRPPHLKY--PPSAK-FVALVARGECVFERKIRVA-- 107
            ::|.:.|....:..||.|...:   |.|...|:.|:  |...| ::||:.:|.|.:..|||.|  
  Rat    75 RYGEHSPKQDARGEVVMASSVH---DRLACDPNTKFAAPAHGKHWIALIPKGNCTYRDKIRNAFL 136

  Fly   108 QNASYSAVIVYN-----NEGDDLEQMSAENITGIRIPSVFVGHTTGKALATYFTTEVVLIINDEL 167
            |||  |||:::|     ||...:.....|:|..|.||     ...||.|.:.....|.:    .:
  Rat   137 QNA--SAVVIFNVGSNTNETITMPHAGVEDIVAIMIP-----EPKGKELVSLLERNVTV----TM 190

  Fly   168 PFNINTQLILPF-----SILIGMCFIIMVI----YMIYKCI----------REQRRLRRHRLPKS 213
            ...|.|:.:..:     .:.:.:.||:::|    ::::..|          |.||||  ....|.
  Rat   191 YITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRL--GDAAKK 253

  Fly   214 MLKKLPV--LRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPIC 276
            .:.||.|  :|.......:.:|.|.:|:|.:...|.:|:|||.|.:|..|:||||.:: |.||:|
  Rat   254 AISKLQVRTIRKGDKETESDFDNCAVCIEGYKPSDVVRILPCRHLFHKSCVDPWLLDH-RTCPMC 317

  Fly   277 KRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSAS 327
            |..:.      .:....|:.|.:     |..|:..:....|....|::.||
  Rat   318 KMNIL------KALGIPPNADCM-----DDLPIDFEGSLGGPPTNQITGAS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 37/132 (28%)
zf-RING_2 233..277 CDD:290367 19/43 (44%)
Rnf150NP_001178022.1 PA_GRAIL_like 45..192 CDD:239037 37/130 (28%)
UPF0233 <206..>231 CDD:299753 3/24 (13%)
zf-RING_2 275..318 CDD:290367 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.