DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and CG33552

DIOPT Version :10

Sequence 1:NP_649653.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster


Alignment Length:86 Identity:21/86 - (24%)
Similarity:37/86 - (43%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 RRHRLPKSMLKKLPVLRYTKNNANN---------KYDTCVICLEDF-IEDDKLRV-LPCSHPYHT 259
            :...:.|.:..:|.......|.|.|         :.:.|.||..:: :..|...| :.|.|.:..
  Fly    51 KEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGA 115

  Fly   260 HCIDPWLTENRRVCPICKRKV 280
            :||..:|..| :.|||||.::
  Fly   116 NCILHYLQRN-KTCPICKSQM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_649653.1 PA_C_RZF_like 14..171 CDD:239038
RING-H2_RNF13-like 233..278 CDD:438327 15/46 (33%)
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.