DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Srsf8

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006257042.2 Gene:Srsf8 / 317533 RGDID:1563383 Length:783 Species:Rattus norvegicus


Alignment Length:211 Identity:45/211 - (21%)
Similarity:87/211 - (41%) Gaps:57/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RKIRVAQNASYSAVIVYNNEGDDLEQMSAENITG------------IRIPSVFVGHTTGKALATY 154
            ||::...:...|:|.:.|:     ...|..||..            :.:|::...:|.|..:.:.
  Rat   588 RKVQSGHSNISSSVSITNS-----NSTSNSNINNSLLSLLNYSQQFLPVPNIIANNTIGNDINSP 647

  Fly   155 FTTEV--------------------VLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCI 199
            .|:::                    :.:|:.|:..:.::..:||                .:...
  Rat   648 HTSQINKECDEFFLFHYPPLEARQQMHVISPEISNDSDSWPLLP----------------DFSNF 696

  Fly   200 REQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDP 264
            .:........|.|..:..|||..:.:   |:|.:.|.||:..:.::.|:|||||.|.||..|||.
  Rat   697 NDIHNNHPKGLTKEQINTLPVKTFCE---NDKLNHCSICITPYTQNSKIRVLPCFHEYHDKCIDR 758

  Fly   265 WLTENRRVCPICKRKV 280
            ||::| ..||||::::
  Rat   759 WLSDN-STCPICRKQI 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 14/100 (14%)
zf-RING_2 233..277 CDD:290367 21/43 (49%)
Srsf8XP_006257042.2 RRM <26..175 CDD:223796
RRM_SF 28..100 CDD:302621
zf-RING_2 727..770 CDD:290367 21/43 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.