DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rnf128

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001166820.1 Gene:Rnf128 / 315911 RGDID:1566282 Length:428 Species:Rattus norvegicus


Alignment Length:380 Identity:86/380 - (22%)
Similarity:141/380 - (37%) Gaps:80/380 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FGPNLPSNGLKVYVVPARRP--YYGCDSLDRPPHLKYP-PS-------AKFVALVAR-GECVFER 102
            :|.:.|...:...:||...|  ...|:     ||..:. |:       ..::||:.| |.|.|..
  Rat    71 YGQDSPLEPVSGVLVPPDGPGALNACN-----PHTNFTVPTVWGSTVQVSWLALIQRGGGCTFAD 130

  Fly   103 KIRVAQNASYSAVIVYNNEGDDLEQMSAENITGIRIPSVFVGHTTGKALATYF-----TTEVVLI 162
            ||.:|.....|..:::|..|...|.:...:.....|.::.:|:..|..:....     .|.|:.:
  Rat   131 KIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEV 195

  Fly   163 INDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSMLK----------K 217
            .....|: :|...|...|:...:.....|.|.|:...|..|..|.....:..||          :
  Rat   196 GKKHGPW-VNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQ 259

  Fly   218 LPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKVF- 281
            |..|:..........|:|.:|:|.:..:|.:|:|.|:|.:|..|:||||.|: |.||:||..:. 
  Rat   260 LRTLKQGDKEIGPDGDSCAVCIELYKPNDVVRILTCNHIFHKTCVDPWLLEH-RTCPMCKCDILK 323

  Fly   282 --------TKGEA--------RASRSRQP-SLDNVTDTDD---------DTTPLLQQQQSNGRQV 320
                    ..|..        .||.:..| ..||.::|..         |..||.:..||....:
  Rat   324 ALGIEVDVEDGSVSLQVPVSNEASNTASPHEEDNRSETASSGYASVQGADEPPLEEHAQSANENL 388

  Fly   321 GQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENAL 375
            ..|:.         .::|||...|.           |.....|||.::.|.|.|:
  Rat   389 QLVNH---------EANSVAVDVVP-----------HVDNPTFEEDETPDQEMAV 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 28/137 (20%)
zf-RING_2 233..277 CDD:290367 19/43 (44%)
Rnf128NP_001166820.1 PA_GRAIL_like 48..193 CDD:239037 26/126 (21%)
zf-RING_2 275..318 CDD:290367 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.