DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:238 Identity:66/238 - (27%)
Similarity:94/238 - (39%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LVARGECVFERKIRVAQNASYSAVIVYNNEGDD---LEQMSAE---NITGIRIPSVFVG------ 144
            ||.||:|.:..|...||...:..|||.:|....   |..|.|.   :.:.:.|||:||.      
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYNL 210

  Fly   145 ------HTTGKALATYFTTEVVLIINDELPFNINTQLILPFSILIGMCF---IIMVIYM----IY 196
                  |:..:.|..|...|       ||     ..:..||.    :||   |||:|.:    |.
pombe   211 LWSDLLHSYRQPLKLYAKPE-------EL-----GDMFWPFL----LCFSPSIIMLITVQALAIR 259

  Fly   197 KCIREQRRLRRHR-----LPKSMLKK-------------------LPVLRYTKNNANNKYDTCVI 237
            |.||..|...:.|     ||...:.:                   :|::..:...|....: |||
pombe   260 KFIRTYRTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVE-CVI 323

  Fly   238 CLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKV 280
            |||.|.:.||:..|||.|.:|..||..|:.:.|..||.|..:|
pombe   324 CLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 26/96 (27%)
zf-RING_2 233..277 CDD:290367 20/43 (47%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 66/238 (28%)
Peptidases_S8_S53 <144..211 CDD:299169 20/64 (31%)
zf-RING_2 320..362 CDD:290367 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47349
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 1 1.000 - - X670
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.