DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and RNF215

DIOPT Version :10

Sequence 1:NP_649653.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001017981.1 Gene:RNF215 / 200312 HGNCID:33434 Length:377 Species:Homo sapiens


Alignment Length:79 Identity:29/79 - (36%)
Similarity:44/79 - (55%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWL 266
            :||:.| ||.....::..:.|..:...:...:||.:||:.|.....||||||.|.:|..|:||||
Human   293 KRRVVR-RLASLKTRRCRLSRAAQGLPDPGAETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWL 356

  Fly   267 TENRRVCPICKRKV 280
            . .::.||:||..|
Human   357 M-LQQTCPLCKFNV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_649653.1 PA_C_RZF_like 14..171 CDD:239038
RING-H2_RNF13-like 233..278 CDD:438327 21/44 (48%)
RNF215NP_001017981.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RING-H2_RNF215 323..372 CDD:438332 23/48 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.