powered by:
Protein Alignment gzl and Rlim
DIOPT Version :9
Sequence 1: | NP_001097695.1 |
Gene: | gzl / 40791 |
FlyBaseID: | FBgn0037442 |
Length: | 536 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001345134.1 |
Gene: | Rlim / 19820 |
MGIID: | 1342291 |
Length: | 600 |
Species: | Mus musculus |
Alignment Length: | 75 |
Identity: | 34/75 - (45%) |
Similarity: | 47/75 - (62%) |
Gaps: | 4/75 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCP 274
|.|..:..|.:..:.:|:| ..||.:|:.::.|.:|||.|||||.||.||||.||:|| ..||
Mouse 524 LTKEQIDNLAMRSFGENDA---LKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSEN-STCP 584
Fly 275 ICKRKVFTKG 284
||:|.|.:.|
Mouse 585 ICRRAVLSSG 594
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4628 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1487241at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.