DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and Rlim

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001345134.1 Gene:Rlim / 19820 MGIID:1342291 Length:600 Species:Mus musculus


Alignment Length:75 Identity:34/75 - (45%)
Similarity:47/75 - (62%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCP 274
            |.|..:..|.:..:.:|:|   ..||.:|:.::.|.:|||.|||||.||.||||.||:|| ..||
Mouse   524 LTKEQIDNLAMRSFGENDA---LKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSEN-STCP 584

  Fly   275 ICKRKVFTKG 284
            ||:|.|.:.|
Mouse   585 ICRRAVLSSG 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 25/43 (58%)
RlimNP_001345134.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..497
RING_Ubox 544..588 CDD:388418 26/44 (59%)
PDZ-binding. /evidence=ECO:0000255 597..600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.