DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and RNF133

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_631914.1 Gene:RNF133 / 168433 HGNCID:21154 Length:376 Species:Homo sapiens


Alignment Length:395 Identity:101/395 - (25%)
Similarity:153/395 - (38%) Gaps:102/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VGGHVLVYRKATSQLIEEFNDLPAQFGPNLPSNGLK----VYVVPARRPYYGCDSLDRPPHLKYP 84
            ||.|||      |:|.|     ...||   .|:.||    |.|.|..:....|:........|| 
Human    48 VGNHVL------SELGE-----TGVFG---RSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKY- 97

  Fly    85 PSAKFVALVARGECVFERKIRVAQNASYSAVIVYNNEG-------------DDLEQMSAENITGI 136
             |..::||:.||.|.|.:||:||.....|.||:||..|             :|:..:...|:.|.
Human    98 -SETWLALIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGT 161

  Fly   137 RIPSVFVGHTTGKALATYFTTEV----VLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYK 197
            .|     .|...|.:......||    ::.:|         ..::.|.|:........:.|.|::
Human   162 EI-----FHLIKKGVLITAVVEVGRKHIIWMN---------HYLVSFVIVTTATLAYFIFYHIHR 212

  Fly   198 -CIREQRRLRRHRLPKSMLK-----KLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHP 256
             |:...:..|..||...:..     :|.|::......|...|:||||.|.:..:|.:|:|.|.|.
Human   213 LCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHF 277

  Fly   257 YHTHCIDPWLTENRRVCPICK---RKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGR 318
            :|.:|||||:..: ..|||||   .||.         ..|..::|.|:.       ||...||  
Human   278 FHKNCIDPWILPH-GTCPICKCDILKVL---------GIQVVVENGTEP-------LQVLMSN-- 323

  Fly   319 QVGQVSSAS-----SAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENALLAS 378
            ::.:..|.|     :....||:|..|.                |...||  .||::|.:...:..
Human   324 ELPETLSPSEEETNNEVSPAGTSDKVI----------------HVEENP--TSQNNDIQPHSVVE 370

  Fly   379 TVRPA 383
            .|.|:
Human   371 DVHPS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 45/167 (27%)
zf-RING_2 233..277 CDD:290367 20/43 (47%)
RNF133NP_631914.1 PA_GRAIL_like 43..177 CDD:239037 42/149 (28%)
RING_Ubox 254..302 CDD:327409 22/48 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..376 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.