DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and ZNRF4

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_859061.3 Gene:ZNRF4 / 148066 HGNCID:17726 Length:429 Species:Homo sapiens


Alignment Length:349 Identity:101/349 - (28%)
Similarity:160/349 - (45%) Gaps:57/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLCLVCHEATLVGGHVLVYRKATSQLIEE-------FNDLPAQFGPNLPSNGLKVYVVPARRPYY 70
            |..||..:|.||...:.|..:|..:.:.|       |.||||.||..|...|::.|::.. :|..
Human    77 GRALVAVKALLVLSLLQVPAQAVVRAVLEDNSSSVDFADLPALFGVPLAPEGIRGYLMEV-KPAN 140

  Fly    71 GCDSLDRPPHLKYPPSAKFVALVARGECVFERKIRVAQNASYSAVIVYNNEGDDLEQMS--AENI 133
            .|..::.|........|  :.|:.|.:|.|:.|:..||.|.:.|.||:|...|||..|:  .|::
Human   141 ACHPIEAPRLGNRSLGA--IVLIRRYDCTFDLKVLNAQRAGFEAAIVHNVHSDDLVSMTHVYEDL 203

  Fly   134 TG-IRIPSVFVGHTTGKALATYF----TTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVIY 193
            .| |.||||||.....:.|....    :...:|:.:|....::....:|..|.::| |.:.:|:.
Human   204 RGQIAIPSVFVSEAASQDLRVILGCNKSAHALLLPDDPPCHDLGCHPVLTVSWVLG-CTLALVVS 267

  Fly   194 MIY----------KCIREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKL 248
            ..:          .|...:|.::     .|..:|..|..:|.:|     |.|.|||:::.|.|:|
Human   268 AFFVLNHLWLWAQACCSHRRPVK-----TSTCQKAQVRTFTWHN-----DLCAICLDEYEEGDQL 322

  Fly   249 RVLPCSHPYHTHCIDPWLTE-NRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQ- 311
            ::|||||.||..|||||.:: .||.||:||:.|         .:.:.|.|:.|.:..|..|.|. 
Human   323 KILPCSHTYHCKCIDPWFSQAPRRSCPVCKQSV---------AATEDSFDSTTYSFRDEDPSLPG 378

  Fly   312 --------QQQSNGRQVGQVSSAS 327
                    |.|...|::..:..||
Human   379 HRPPIWAIQVQLRSRRLELLGRAS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 50/170 (29%)
zf-RING_2 233..277 CDD:290367 24/44 (55%)
ZNRF4NP_859061.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..67
PA_C_RZF_like 86..244 CDD:239038 47/160 (29%)
zf-RING_2 307..352 CDD:290367 24/44 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8867
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41191
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.