DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and rnf6

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_017209360.1 Gene:rnf6 / 100359398 ZFINID:ZDB-GENE-100209-1 Length:799 Species:Danio rerio


Alignment Length:74 Identity:27/74 - (36%)
Similarity:43/74 - (58%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LPKSMLKKLPVLRYTKNNANNKYD-TCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC 273
            |.|..:..|....|.:.|...:.. .|.:|:.::.:.:|||.|||:|.:|.||||.||:|| ..|
Zfish   723 LTKEQIDNLVTRTYGQVNLEGEQGRACSVCINEYAQGNKLRRLPCAHEFHIHCIDRWLSEN-NTC 786

  Fly   274 PICKRKVFT 282
            |||::.:.:
Zfish   787 PICRQPILS 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 21/44 (48%)
rnf6XP_017209360.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.