powered by:
Protein Alignment gzl and rnf6
DIOPT Version :9
Sequence 1: | NP_001097695.1 |
Gene: | gzl / 40791 |
FlyBaseID: | FBgn0037442 |
Length: | 536 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017209360.1 |
Gene: | rnf6 / 100359398 |
ZFINID: | ZDB-GENE-100209-1 |
Length: | 799 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 27/74 - (36%) |
Similarity: | 43/74 - (58%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 LPKSMLKKLPVLRYTKNNANNKYD-TCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC 273
|.|..:..|....|.:.|...:.. .|.:|:.::.:.:|||.|||:|.:|.||||.||:|| ..|
Zfish 723 LTKEQIDNLVTRTYGQVNLEGEQGRACSVCINEYAQGNKLRRLPCAHEFHIHCIDRWLSEN-NTC 786
Fly 274 PICKRKVFT 282
|||::.:.:
Zfish 787 PICRQPILS 795
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
gzl | NP_001097695.1 |
PA_C_RZF_like |
14..171 |
CDD:239038 |
|
zf-RING_2 |
233..277 |
CDD:290367 |
21/44 (48%) |
rnf6 | XP_017209360.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1487241at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.