DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and rnf128

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:371 Identity:96/371 - (25%)
Similarity:150/371 - (40%) Gaps:82/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FGPNLP---SNGLKVYVVPARRPYYGC-DSLD-RPPHLKYPPSAKFVALVAR-GECVFERKIRVA 107
            ||.:.|   :.|| |.:..:.|.:..| |:.: ..||....|   ::||:.| |.|.|..||..|
 Frog    57 FGQDSPIERAAGL-VVLPKSERTFTACKDNTNFSVPHNWNGP---WIALILRGGGCTFTEKINRA 117

  Fly   108 QNASYSAVIVYNNEGDDLEQMSAENITGIRIPSVFVGHTTGKALATYFTTEVVLIINDELPFNIN 172
            ......||:|||| |.|.|.....:.......::.:|:..|        .|:|.:|...:...:.
 Frog   118 AERGARAVVVYNN-GMDNEVFEMSHPGTKDTVAIMIGNIKG--------NEIVEVIKGGMQVMMV 173

  Fly   173 TQL-------ILPFSI-LIGMCFIIM----VIYMIYKCIREQRRLRRHRLPKSMLKKLPVLRYTK 225
            .::       |..:|| .:.:.|.|:    |.|.|:      ...||.||.::..||:..|:...
 Frog   174 IEVGRKHGSWINHYSIFFVSVSFFIVTAATVGYFIF------YSARRWRLTRAQNKKMKQLKAEA 232

  Fly   226 NNANNKY----------------DTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCP 274
            ..|..|.                |:|.:|:|.:...|.:|:|.|:|.:|.:||||||.|: |.||
 Frog   233 KKAIGKLQLRTIKQGDKVLGPDGDSCAVCIEPYKPSDVVRILTCNHFFHKNCIDPWLLEH-RTCP 296

  Fly   275 ICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSSASSAGGAAGSSSSV 339
            :||..:.            .|| .:.:.:::||.......|:..|...|.:......:..:||..
 Frog   297 MCKCDIL------------KSL-GIAEDEEETTSAAIPSVSSELQRSTVQTIEEENRSEMASSGY 348

  Fly   340 AAAAVAGTTRHGTFRRGHAGRNPFEESQSSDDENALLASTVRPATS 385
            |:.            ||  |..|.:|.|.. .||..|......|||
 Frog   349 ASV------------RG--GDEPVDEGQHI-YENTELVHNEASATS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 35/127 (28%)
zf-RING_2 233..277 CDD:290367 20/43 (47%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037 35/129 (27%)
COG5540 <208..302 CDD:227827 32/100 (32%)
RING-H2_RNF128_like 256..304 CDD:319716 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.