| Sequence 1: | NP_001138014.2 | Gene: | CG1024 / 40789 | FlyBaseID: | FBgn0027514 | Length: | 543 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001128556.1 | Gene: | Zfp322a / 680201 | RGDID: | 1594230 | Length: | 399 | Species: | Rattus norvegicus |
| Alignment Length: | 219 | Identity: | 44/219 - (20%) |
|---|---|---|---|
| Similarity: | 78/219 - (35%) | Gaps: | 65/219 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 339 ISYLCPKCGKEIASMDGWRAHVFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKH 403
Fly 404 CFKHLPYRSYLKCTLCDRTKTSTSKILNHIRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQAA- 467
Fly 468 -------MADDAGSEDDQ------------GEQA-VCEHCDRVFRSKWRYERH-----------I 501
Fly 502 ASCRRSGAGKSVEGTVEALLNHLR 525 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1024 | NP_001138014.2 | C2H2 Zn finger | 30..51 | CDD:275368 | |
| C2H2 Zn finger | 73..100 | CDD:275368 | |||
| C2H2 Zn finger | 106..123 | CDD:275368 | |||
| Zfp322a | NP_001128556.1 | COG5048 | <68..218 | CDD:227381 | 32/150 (21%) |
| C2H2 Zn finger | 72..92 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 100..120 | CDD:275368 | 4/24 (17%) | ||
| C2H2 Zn finger | 128..148 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 140..165 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 156..176 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 168..192 | CDD:290200 | 3/23 (13%) | ||
| C2H2 Zn finger | 184..204 | CDD:275368 | 7/25 (28%) | ||
| C2H2 Zn finger | 212..232 | CDD:275368 | |||
| C2H2 Zn finger | 240..260 | CDD:275368 | |||
| C2H2 Zn finger | 268..288 | CDD:275368 | |||
| C2H2 Zn finger | 294..314 | CDD:275368 | |||
| C2H2 Zn finger | 322..344 | CDD:275368 | |||
| C2H2 Zn finger | 352..372 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24409 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||