DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and Sry-delta

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:473 Identity:93/473 - (19%)
Similarity:157/473 - (33%) Gaps:150/473 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VHLLDTHMREIEKYENKLRQMKRQQAKPTTAAAPAGNA-EKPMAVKPRGR--PKGSTNRKQNDLL 182
            |.|.||......:||....::...|...:.......|. :..:.:||..|  |:........|.:
  Fly    10 VDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSDYDTI 74

  Fly   183 QKALMDID--LNTEMEKSPVTALAAPVNEPKPISNVSELNLDRCLNAYEDIVRKE----EKEVVP 241
            ...||...  |.|:::    .||.:....|:               :.|||:.:|    :.:|..
  Fly    75 MVNLMTTQKRLTTQLK----GALKSEFEVPE---------------SGEDILVEEVEIPQSDVET 120

  Fly   242 KYDDELDALCKEFFDDGPSAG---KGE-ANEEQQQDDAHLQQGNQEVVIIEIDALGKEEVAQLKK 302
            ..|.|.|||..|...|...:.   |.| .:||:::||    ..:.|.:..::| :|..|....| 
  Fly   121 DADAEADALFVELVKDQEESDTEIKREFVDEEEEEDD----DDDDEFICEDVD-VGDSEALYGK- 179

  Fly   303 EMKSDPISQPTKRRRISTTPSRDSDTEMSTNGLTKLISYLCPKCGKEIASMDGWRAHVFKKHDFE 367
              .||...:|||:|                      :...|..|||...|....:.|:.::|..:
  Fly   180 --SSDGEDRPTKKR----------------------VKQECTTCGKVYNSWYQLQKHISEEHSKQ 220

  Fly   368 --HI-------------IENSFKILESGRKAMCLQC-----REVQPTTVR--------------- 397
              ||             :|....:.|...:..|..|     |.|  .|:|               
  Fly   221 PNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPV--NTLRHMRMHWDKKKYQCEK 283

  Fly   398 -----SQ---LQKHCFKHLPYRSYLKCTLCDRTKTSTSKILNHIRYNHQEELQR-------KNKT 447
                 ||   |..|..:|....:.:.|::|: ....:.|..||....|:|...|       |:.|
  Fly   284 CGLRFSQDNLLYNHRLRHEAEENPIICSICN-VSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFT 347

  Fly   448 QLL----------------IKPEPMWASPNKSGQAAMADDAGSEDDQGEQAV------------- 483
            :..                ::.|    :|  :.:..:.::...:.|:.|.||             
  Fly   348 ERYTLKMHMKTHEGDVVYGVREE----AP--ADEQQVVEELHVDVDESEAAVTVIMSDNDENSGF 406

  Fly   484 CEHCDRVFRSKWRYERHI 501
            |..|:..|.:|...|.|:
  Fly   407 CLICNTNFENKKELEHHL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368 1/1 (100%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 28/157 (18%)
C2H2 Zn finger 225..245 CDD:275368 1/19 (5%)
C2H2 Zn finger 253..273 CDD:275368 6/21 (29%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
C2H2 Zn finger 310..327 CDD:275370 5/17 (29%)
zf-C2H2 337..359 CDD:278523 2/21 (10%)
C2H2 Zn finger 339..359 CDD:275368 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.