DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and Sry-beta

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:356 Identity:71/356 - (19%)
Similarity:124/356 - (34%) Gaps:116/356 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 KPISNVSELNLDRCLNAYEDIVRKEEKEVVP-------------KYD-----------DELDAL- 250
            |||.::        |..:|.|: .:..|::|             .||           ...||| 
  Fly    33 KPIKDI--------LKYFEKII-NQRLELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALL 88

  Fly   251 -CKEFFDDGPSAGKGEANEEQQQDDAHLQQGNQEVVIIEIDAL-------GKEEVAQ--LKKEMK 305
             |::.      .||.| .::|....|.:|.  ....|::..||       |:|:..:  :|:||.
  Fly    89 GCRQV------EGKAE-TKQQAAKRARVQV--PAFKIVQATALKEPERQPGEEDECEEFMKEEML 144

  Fly   306 SD--PISQPTKRRRISTTPSRDSDTEMSTNGLTKLISYLCPKCGKEIASMDGWRAHVFKKHDFEH 368
            .:  ..|:|.     .:.||.:.:.      .|:.....|..||:..:|.:....|:  |.|   
  Fly   145 DEEFQFSEPD-----DSMPSSEEEF------FTETTEIPCHICGEMFSSQEVLERHI--KAD--- 193

  Fly   369 IIENSFKILESGRKAMCLQC-REVQPTTVRSQLQKHCFKHLPYRSYLKCTLCDRTKTSTSKILNH 432
                   ..:...:|.|..| .:|:...|   |..|...| ..::.|:|..||:..:....:|.|
  Fly   194 -------TCQKSEQATCNVCGLKVKDDEV---LDLHMNLH-EGKTELECRYCDKKFSHKRNVLRH 247

  Fly   433 IRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQA-----AMADDAGSEDDQGEQAVCEHCDRVFR 492
            :..:..     |.|.|.           :|.|:.     .|.:.....|.:....:||.|.:.|:
  Fly   248 MEVHWD-----KKKYQC-----------DKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFK 296

  Fly   493 SKWRYERHIAS------------CRRSGAGK 511
            :|..|:.|:.:            |.:|...|
  Fly   297 TKRTYKHHLRTHQTDRPRYPCPDCEKSFVDK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/22 (27%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..308 CDD:275368 11/59 (19%)
C2H2 Zn finger 288..303 CDD:275370 6/14 (43%)
zf-C2H2 315..337 CDD:278523 3/13 (23%)
C2H2 Zn finger 317..337 CDD:275368 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.