DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG3281

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:441 Identity:86/441 - (19%)
Similarity:138/441 - (31%) Gaps:182/441 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LKKTYSDFNFIQIDERFHECQLCFK----------WVENAHKTIALLQYHYFMHLE--------H 100
            ||.|::|.|.     ..|.||.|.:          .|||||:|:..|    |...|        |
  Fly    51 LKWTWTDPNL-----PMHLCQNCARRLIGAYEFIVEVENAHETLQNL----FEQQEVAAKPDEVH 106

  Fly   101 SETYRCVHCRMAYTRRRALNVHLLDTHMREIEKY-------------ENKLRQMKRQQAKPTTAA 152
            .:....:......:..:.|:....:.|:...|||             |..|...:.:..:|    
  Fly   107 VDVVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEP---- 167

  Fly   153 APAGNAEKPMAVKPRGRPKGSTNRKQNDLLQKALMDIDLNTEMEKSPVTALAAPVNEPKPISNVS 217
                  |....:||  ||....||:                             ::.|..:.  |
  Fly   168 ------EDSFQLKP--RPDEIENRE-----------------------------LSRPSQLG--S 193

  Fly   218 ELN-----LDRCLNAYEDIVRKEEKEVVPKYDDELDALCKEFFD-------------DGPSAGKG 264
            .||     :.:|             .|.|:...:.::|.:.|..             ...|.|.|
  Fly   194 RLNHSANFIYKC-------------AVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTG 245

  Fly   265 EANEE------QQQDD--AHLQQGNQEVVIIEIDALGKEEVAQLKKEMKSDPISQPTKRRRISTT 321
            ....|      ::||.  .|:|..:.:.:     ||..||.            :..:.|:||:  
  Fly   246 LLTCEHCPRTFKRQDTLRRHMQAFHPDAI-----ALEPEET------------TDNSARKRIA-- 291

  Fly   322 PSRDSDTEMSTNGLTKLISYLCPKCGKE--IASMDGWRAHVFKKHDFEHIIENSFKILESGRKAM 384
            ..||                 ||.||..  ::|:   ..|:.:     |..:|.:|         
  Fly   292 KRRD-----------------CPHCGLSFPVSSL---TIHIRR-----HTGDNPYK--------- 322

  Fly   385 CLQCREVQPTTVRSQ-LQKHCFKHLPYRSYLKCTLCDRTKTSTSKILNHIR 434
            |.||.:..|   ||| |..|..:|...|. .:|.:|.:...|.:|:..|:|
  Fly   323 CDQCEKAFP---RSQDLSLHMRQHTGERP-SECKICSKKFISQNKLARHMR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368 12/44 (27%)
C2H2 Zn finger 106..123 CDD:275368 1/16 (6%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 15/45 (33%)
C2H2 Zn finger 205..226 CDD:275368 5/33 (15%)
C2H2 Zn finger 249..266 CDD:275368 3/16 (19%)
COG5048 <294..>391 CDD:227381 28/114 (25%)
C2H2 Zn finger 296..315 CDD:275368 6/26 (23%)
zf-H2C2_2 307..330 CDD:290200 8/39 (21%)
C2H2 Zn finger 323..343 CDD:275368 9/22 (41%)
zf-H2C2_2 335..358 CDD:290200 6/23 (26%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 2/6 (33%)
C2H2 Zn finger 379..399 CDD:275368
zf-H2C2_2 391..416 CDD:290200
C2H2 Zn finger 407..424 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.