DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG2678

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:334 Identity:65/334 - (19%)
Similarity:110/334 - (32%) Gaps:99/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SAGKGEANE---EQQQDDAHLQQGNQEVVIIE--IDALGKEEVAQLKKEMKSDPISQP------- 312
            :|..|:.|:   ::.|..:..||..|::...:  .|.|.:::..|.|  ::...|..|       
  Fly   102 AACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQKQTLQAK--LQEGNIDGPPESFTLH 164

  Fly   313 TKRRRISTTPSRDSDTEMSTNGLTKLIS-----YLCPKCGKEIASMDGWRAHVFKKHDFEHIIEN 372
            .::|...|....|...:.:|.. ||:|.     |.||.|.|...|....|.|:            
  Fly   165 PRKRTCRTEEQADMIPKEATRS-TKMICDADGYYNCPHCSKRFCSQTQLRTHI------------ 216

  Fly   373 SFKILESGRKAMCLQCREVQPTTV-RSQLQKHCFKHLPYRSYLKCTLCDRTKTSTSKILNHIRYN 436
                     ..:|.:|.....|.: :|.|::|...||...:: ||..|.:.......:..|:|.:
  Fly   217 ---------TDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAH-KCFHCSKAFMRKDHLKRHLRTH 271

  Fly   437 H------------------QEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDAGSEDDQGE--- 480
            .                  |.|:.|:...|          .|..|...:..|....:.||.:   
  Fly   272 DSDGPLSCSQCSAVFIEHVQLEIHRREHKQ----------RPGSSKSESTKDPDSDDSDQAQDLK 326

  Fly   481 --------------------QAVCEHCDRVFRSKWRYERHIASCRRSGAGK-----SVEGTVEAL 520
                                :.:|:.|.:.|.|.:..:||:.:..|....|     |.|...|..
  Fly   327 PKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKH 391

  Fly   521 LNHLREGHM 529
            |.....|||
  Fly   392 LKRHERGHM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 13/64 (20%)
C2H2 Zn finger 223..243 CDD:275368 5/19 (26%)
zf-C2H2 249..271 CDD:278523 5/22 (23%)
C2H2 Zn finger 251..271 CDD:275368 4/19 (21%)
C2H2 Zn finger 279..299 CDD:275368 3/19 (16%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 4/19 (21%)
C2H2 Zn finger 406..427 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.