DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and Neu2

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:419 Identity:85/419 - (20%)
Similarity:119/419 - (28%) Gaps:174/419 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 VNEPKPISN-VSELNLDRCLNAYEDI---------------VRKEEKEVVPKYDDELDALCKEFF 255
            |.:..|:|| :.:..|:...||::.|               ||:||.|                 
  Fly    27 VEKHDPLSNTICKSCLEDAQNAFDIIETYERSHQFYRFLKDVREEESE----------------- 74

  Fly   256 DDGPSAGKG-EANEEQQQDDAHLQQGNQEVVIIEIDALGKEE--------------VAQLKKEMK 305
            :||....:. ||.|...||.|.......|..|.|.|...||:              .:.||..|:
  Fly    75 NDGSGCSEEVEAAERDLQDGADDVDSGNEPDINECDIKAKEKPGFSCSHCPKSFQVKSNLKVHMR 139

  Fly   306 SDPISQPTKRRRISTTP-----SRDSDTEMSTNGLTKLISYLCPKCGKEIASMDGWRAH------ 359
            |....:|.   ..|..|     |......|.|:  |....:.|..|.:...:....:||      
  Fly   140 SHTGERPF---TCSLCPKSFGYSSGLQNHMRTH--TGERPFQCSHCPRSFTAGHHLKAHIQMHER 199

  Fly   360 -----------------VFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQK----- 402
                             :.|:|...|..|..||         |.||.  :...|..:|..     
  Fly   200 RGSLRCPYCQKCFLTSLILKQHLATHTDETQFK---------CSQCS--KSFQVEHELWMHMRVH 253

  Fly   403 --------HCFKHLPYRSY----------------------------LKCTLCDRTKTSTSKILN 431
                    ||.|.....:|                            |||..|.:|.|..|.:..
  Fly   254 QERLFTCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALST 318

  Fly   432 HIRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDAGSEDDQGEQAVCEHCDRVFRSKWR 496
            |:: :|     .|||        |:...|.||..:..|    ..:.|.:...|..|.|.|..|  
  Fly   319 HLK-SH-----TKNK--------PLLEGPCKSSGSKPA----HSNAQRKPFKCSSCPRTFSRK-- 363

  Fly   497 YERHIASCRRSGAGKSVEGTVEALLNHLR 525
                                 .|||.||:
  Fly   364 ---------------------SALLTHLQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 8/35 (23%)
COG5048 <119..241 CDD:227381 24/137 (18%)
C2H2 Zn finger 121..141 CDD:275368 3/19 (16%)
zf-H2C2_2 133..158 CDD:290200 7/27 (26%)
C2H2 Zn finger 149..169 CDD:275368 4/19 (21%)
zf-H2C2_2 162..185 CDD:290200 5/24 (21%)
C2H2 Zn finger 177..197 CDD:275368 4/19 (21%)
C2H2 Zn finger 205..225 CDD:275368 2/19 (11%)
zf-C2H2_8 206..286 CDD:292531 15/90 (17%)
C2H2 Zn finger 233..253 CDD:275368 5/21 (24%)
C2H2 Zn finger 260..297 CDD:275368 4/36 (11%)
C2H2 Zn finger 303..323 CDD:275368 6/20 (30%)
C2H2 Zn finger 353..373 CDD:275368 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.