DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG10654

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:116 Identity:29/116 - (25%)
Similarity:41/116 - (35%) Gaps:34/116 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AHMVYICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDERFHE---------CQLCFK- 78
            |.::|.||.|.|.:......:.|:...|                ||:||         |:.|.| 
  Fly   283 ARIIYACPSCNKVYTANRSLKYHMRRTH----------------ERYHESESPDARHICEECGKC 331

  Fly    79 WVENAHKTIALLQYHYFMHLEHSETYRCVHC--RMAYTRRRALNVHLLDTH 127
            :...||     |..|..:|........|..|  |..||:...:: |||..|
  Fly   332 FARKAH-----LTRHKMVHGSVEGRRYCCECCDRRFYTKENMVD-HLLRKH 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 5/20 (25%)
C2H2 Zn finger 73..100 CDD:275368 8/27 (30%)
C2H2 Zn finger 106..123 CDD:275368 5/18 (28%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368
C2H2 Zn finger 256..313 CDD:275368 9/45 (20%)
C2H2 Zn finger 289..314 CDD:275368 8/40 (20%)
zf-C2H2 323..345 CDD:278523 7/26 (27%)
C2H2 Zn finger 325..345 CDD:275368 7/24 (29%)
C2H2 Zn finger 355..376 CDD:275368 7/21 (33%)
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.