DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG1529

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:433 Identity:86/433 - (19%)
Similarity:147/433 - (33%) Gaps:147/433 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LLQKALMDIDLNTEMEKSPVTALAAPVNEPKPISNVSELNLDRCLNA--YEDIVRKEEKEVVPK- 242
            :||| |:|||:           |..|...|..|.|:       |.||  |.|.:|:..:|...| 
  Fly    34 ILQK-LLDIDI-----------LKQPHGFPTEICNL-------CHNAVVYFDELRQVARESSQKL 79

  Fly   243 -----YDDELDALCKEFFDDGPSAGKGEANEEQQQDDAHLQQGNQEVVIIEIDALGKEEVAQLK- 301
                 .|..:|.:.:|..|:|..... |.||.:.:::...|...|:|      .|.|::..|.| 
  Fly    80 IGWQPVDIAVDRVKEEPPDEGLKENH-EENEHELEEEHEKQADGQQV------DLSKKQEDQKKI 137

  Fly   302 ------------KEMKSDPISQPT--KRR----------RISTTPSRDSDTEMSTNGLTKLISYL 342
                        .|.....:||.|  |||          ::...|..::.......|.:|  .:|
  Fly   138 LDDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSK--PFL 200

  Fly   343 CPKCGKEIASMDGWRAHVFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKHCFKH 407
            |..|.|.....:..|:|:...|.....::...      |..:|..|.....|  ::.|.:|..:|
  Fly   201 CRSCDKSFTRYEQLRSHMRNAHPQLEQLQQEL------RDLICELCNRQYST--KNALGEHLKRH 257

  Fly   408 LPYRSYLKCTLCDRTKTSTSKILNHIRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDA 472
            ...:.:: |..|...|.:.:::|.|:|.::                 |.|               
  Fly   258 AQRKEHV-CEHCGVAKVTRTELLTHLRTHN-----------------PTW--------------- 289

  Fly   473 GSEDDQGEQAVCEHCDRVFRSKWRYERHI------------ASCRR------------------S 507
                   |:..||.|.::||.|....||:            ..|.:                  :
  Fly   290 -------ERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTEST 347

  Fly   508 GAGKSVEGTVEALLN--------HLREGHMRMNAIWKTMQREK 542
            |:|::.|....|.::        ...|.|:|.:...||.::.:
  Fly   348 GSGEAAEEWPFACIHCQKPCVSRQTLELHLRRHRARKTHRKRR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 19/63 (30%)
C2H2 Zn finger 171..192 CDD:275368 1/20 (5%)
zf-C2H2_2 201..>257 CDD:289522 12/63 (19%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 5/21 (24%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 17/119 (14%)
C2H2 Zn finger 294..315 CDD:275368 8/20 (40%)
C2H2 Zn finger 323..343 CDD:275368 1/19 (5%)
C2H2 Zn finger 360..380 CDD:275368 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.