DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG9609

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:328 Identity:61/328 - (18%)
Similarity:109/328 - (33%) Gaps:100/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTLSDEQSRLNARLEAHMVYICPECGKAFRTQAEWRQHLNTKHDYLKKTYS----DFNFIQIDE- 68
            :::|:....:....|:..||.|.:|...|..:.:.::|...:|. |:..||    ...|.|..: 
  Fly   113 ISVSNMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEIREHT-LEYPYSCSKCSRGFYQQWQC 176

  Fly    69 -------RFHECQLC----FKWV------------ENAH----------KTIALLQYHYFMHLEH 100
                   :.:||..|    .||.            :|.|          |...|.::....|.|.
  Fly   177 QSHEPSCKLYECPGCPLQFDKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLEVKHKEA 241

  Fly   101 SETYRCV--------HCRMAYTRRRALNVHLLDTHM------------REIEKYENKLRQMKRQQ 145
            ::|..|.        .|..:|:..|.|..|:|..|.            |.....:|..|.:.|..
  Fly   242 AQTDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRDH 306

  Fly   146 AKPTTAAAPAGNAEKPMAVKPRGRPKGSTNRKQNDLLQKALMDIDLNTEMEKSPVTALAAPVNEP 210
            ..        |..:|.:..|.:.:.|.....|.....:|...|                |..::.
  Fly   307 KD--------GATKKELKAKKKDKSKTGEGGKTKSTSRKRRRD----------------AGRSKH 347

  Fly   211 KPISNVSELNLDRCLNAYEDIVRKEEKEVVPKY-----DDELDALCKEFFDDGPSAGKGEANEEQ 270
            ..:|.::.|.||:   ..::.||:.:..|:.|.     ||.::.|..:...|         .||:
  Fly   348 SRLSKLACLQLDK---EDDEAVRERQPLVLEKITQSLKDDPVEELLAQTLQD---------EEEK 400

  Fly   271 QQD 273
            :|:
  Fly   401 EQE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 4/20 (20%)
C2H2 Zn finger 73..100 CDD:275368 9/52 (17%)
C2H2 Zn finger 106..123 CDD:275368 5/24 (21%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368
zf-C2H2_8 67..150 CDD:292531 7/36 (19%)
C2H2 Zn finger 67..90 CDD:275368
C2H2 Zn finger 106..126 CDD:275368 1/12 (8%)
C2H2 Zn finger 134..155 CDD:275368 4/20 (20%)
C2H2 Zn finger 188..210 CDD:275368 4/21 (19%)
C2H2 Zn finger 217..237 CDD:275368 2/19 (11%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.