DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG43347

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster


Alignment Length:356 Identity:72/356 - (20%)
Similarity:122/356 - (34%) Gaps:115/356 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLNARLEAHMVY-----------ICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDERF 70
            ||| .||.|..|           :|..||:.|....:.:.|:...|..:.:...||         
  Fly  1236 RLN-YLEMHRTYGCASNPNRSRPVCDFCGRKFCQPQKLKAHIKRMHSDMAEVLRDF--------- 1290

  Fly    71 HECQLCFKWVENAHKTIALLQYH-YFMHLEHSETYRCVHCRMAYTRRRALNVHL----------- 123
             :|:||.|.:.:.    |.||.| ..:|..:|....|..|:..:..|..|.:|:           
  Fly  1291 -QCKLCSKLLGSR----AALQRHSKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGVRPFKC 1350

  Fly   124 --------------LDTHMREIEKY-ENKLRQMKRQQA----------------KPTTAAAPAGN 157
                          |..|.:::..| :.::.:::|..|                |.|..|.||..
  Fly  1351 AEPECNAAFTTKQCLQFHYKKVHNYTQEQMPKIERSVAYTFDAYSGGMKVDFLGKQTATATPASA 1415

  Fly   158 AE-----KPMA--VKPRGRPKGSTNRKQNDLL-QKALMDIDLNTEMEKSPVTALAAPVNEPKPIS 214
            |.     :|.|  |.|....:.:..|::..|. |.:::...|.::.|.|......|.....|.|.
  Fly  1416 ASAQAQPRPNAAVVSPSSFTEQAPRRRRKSLEDQSSMLSGSLQSDAEFSDDNLFEAIKKSGKSIK 1480

  Fly   215 NV--SELNL----DRCLNAYEDIV---------------------RKEEKEVVPKYDDELDALCK 252
            ::  :|.||    .:..:.:.|.|                     ||.:||.|.....:|....:
  Fly  1481 DLCRNEPNLSLLSSKISSIFGDKVPSATASLSASVSAVASSGARKRKRKKEPVVPAQQQLHLHQQ 1545

  Fly   253 EFFDDGPSAGKGEANEEQQQDDAHLQQGNQE 283
            :           :..::|||...|.||..|:
  Fly  1546 Q-----------QQQQQQQQQSQHQQQHQQQ 1565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 5/20 (25%)
C2H2 Zn finger 73..100 CDD:275368 9/27 (33%)
C2H2 Zn finger 106..123 CDD:275368 4/16 (25%)
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 11/32 (34%)
C2H2 Zn finger 1198..1219 CDD:275368
C2H2 Zn finger 1227..1255 CDD:275368 7/19 (37%)
C2H2 Zn finger 1259..1280 CDD:275368 5/20 (25%)
C2H2 Zn finger 1292..1313 CDD:275368 8/24 (33%)
C2H2 Zn finger 1322..1342 CDD:275368 5/19 (26%)
zf-H2C2_2 1334..1361 CDD:290200 2/26 (8%)
C2H2 Zn finger 1350..1373 CDD:275368 2/22 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.