DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and CG2120

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:258 Identity:55/258 - (21%)
Similarity:82/258 - (31%) Gaps:102/258 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDERFHECQLCFKWVENAHKTIALLQY 92
            ::|.||||.||...:.|.|..|               ...||.|:|.:|.|....|:    .|..
  Fly   127 HVCVECGKGFRQLNKLRIHAVT---------------HTAERPHKCDICGKGFRYAN----YLTV 172

  Fly    93 HYFMHLEHSETYRCV--HCRMAYTRRRALNVHLLDTHMREIEKYENKLRQMKRQQAKPTTAAAPA 155
            |..:| ...:.|.|:  .|.:::....|..:|             .|||...:....|       
  Fly   173 HRRLH-TGEKPYPCLATDCHLSFHSIHARRIH-------------TKLRHAAQTDPDP------- 216

  Fly   156 GNAEKPMAVKPRGRPKGSTNRKQNDLLQKALMDIDLNTEMEKSPVTALA--APVNEPKPISNVSE 218
               |.|:|                              |.|:...:||:  .||        .|.
  Fly   217 ---EHPLA------------------------------EQEQRDTSALSFTCPV--------CSR 240

  Fly   219 LNLDRCLNAYEDIVRKEEKEVVPKYDDELDALCKEFFDDGPSAGKG--EANEEQQQDDAHLQQ 279
            :..|:|   |..|..|       ::.::.|..|.:     |..||.  .|:|.:....||.||
  Fly   241 VLTDQC---YLSIHLK-------RHYNQRDFPCPQ-----PECGKRFFSASELKHHQIAHTQQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 10/20 (50%)
C2H2 Zn finger 73..100 CDD:275368 7/26 (27%)
C2H2 Zn finger 106..123 CDD:275368 3/18 (17%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368
zf-H2C2_2 113..138 CDD:290200 6/10 (60%)
C2H2 Zn finger 129..149 CDD:275368 10/34 (29%)
zf-H2C2_2 142..166 CDD:290200 9/38 (24%)
COG5048 151..>264 CDD:227381 35/188 (19%)
C2H2 Zn finger 157..177 CDD:275368 6/23 (26%)
C2H2 Zn finger 185..206 CDD:275368 4/33 (12%)
C2H2 Zn finger 235..255 CDD:275368 8/37 (22%)
C2H2 Zn finger 263..285 CDD:275368 6/26 (23%)
C2H2 Zn finger 293..313 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.