DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1024 and szy-5

DIOPT Version :9

Sequence 1:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_491745.2 Gene:szy-5 / 172281 WormBaseID:WBGene00016154 Length:603 Species:Caenorhabditis elegans


Alignment Length:609 Identity:119/609 - (19%)
Similarity:203/609 - (33%) Gaps:217/609 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLNARLEAHMVYICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDERFHECQLCFKWVE 81
            |:..|..| .:|.|.:|.|..:..::..:|:. ||              ..|:.:.|.:|.....
 Worm    61 RMKKRPPA-QIYHCVQCNKHIKYPSKITEHIR-KH--------------TGEKPNVCSICNISFS 109

  Fly    82 NAHKTIALLQYHYFMHLEHSETYRCVHCRMAYTRRRALNVHLLDTHMREIEKYENKLRQMKR--- 143
            .||.....:|.|     .|.:.|:|..|...:     |||:..:.|..:...:.|....|:.   
 Worm   110 QAHTLKTHMQQH-----AHEKPYKCSFCTAEF-----LNVYEKNEHEEQHMHHPNHGETMEENNA 164

  Fly   144 ------QQAKPTTAAAPA----------------GNAEKPMAVKPRGRPKGSTNRKQNDLLQKAL 186
                  |.|:||..|.|.                ....:.|.|         |:.:|.  :|..|
 Worm   165 TTSQFIQVAEPTIQAEPCQIYECSEMCGFQSYEEAEVVEHMTV---------THYQQT--VQNGL 218

  Fly   187 MDIDLN-------------------TEMEKSP----------------VTALAAPVNEPKPISNV 216
            :..|.|                   ||:|::|                |.|...| :||. :..|
 Worm   219 ILQDFNGEPEPIYEFYEEQYVQQVPTEIEETPTIKQQSIPYENLHFEHVEAAPGP-SEPH-LQVV 281

  Fly   217 SELNLDRCLNAYEDIV----RKEEKEVVPKYDDELDALCKEFFDDGPSAGKGEANEEQQQDDAHL 277
            :|   ...|...|:||    .|..||.:...|..:..:.::..::....|    ||:::::...:
 Worm   282 AE---GEILYDGEEIVDISNGKSLKEEIQNGDANIYGMIQDLEEEVEDIG----NEDEERERVRI 339

  Fly   278 -------QQGNQEV------------VIIEIDALGKEEVAQLKKEMKS--DPISQPTKRRR---- 317
                   ::|.:.:            :|::...|   |:|:..:.:|.  .|||   ||:.    
 Worm   340 MVNPNPPKRGTKSLRDHHEATAATMEMIVDASIL---ELAEPSRHLKQGYPPIS---KRKNTGKR 398

  Fly   318 ------ISTTPSRDSD-TEMSTNGLTKLISYLCPKCGKEIASMDGWRAHVFKKHDFEHIIENSFK 375
                  |....::..| :|.|.:...|...:.|..||:    :|.:.:.: :.|...|..|..||
 Worm   399 AENLDWIIDAVAKGVDVSEASPHHRKKPTLHKCEYCGR----VDKYPSKI-RAHMRTHTGEKPFK 458

  Fly   376 ILESGRKAMCLQCREV--QPTTVRSQLQKHCFKHLPYRSYLKCTL--CDRTKTSTSKILNHIRYN 436
                     |..|...  |.|.:|..|::| |...||    :|.:  |.....|.:.:..|:...
 Worm   459 ---------CEICGMAFSQKTPMRLHLRRH-FDQKPY----ECDVDGCKERFVSGAILKMHVEKK 509

  Fly   437 HQEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDAGSEDDQGEQAVCEH-CDRVFRSKWRYERH 500
            |   |.:|                                    :.||.. |.|||.|.:..:.|
 Worm   510 H---LNKK------------------------------------KYVCSRGCGRVFSSAYNQKHH 535

  Fly   501 IASCRRS------GAGKSVEGTVE 518
            ...|.::      |..:|||...|
 Worm   536 EKKCEQTYVTWVEGEQQSVESGEE 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 4/20 (20%)
C2H2 Zn finger 73..100 CDD:275368 6/26 (23%)
C2H2 Zn finger 106..123 CDD:275368 5/16 (31%)
szy-5NP_491745.2 C2H2 Zn finger 73..93 CDD:275368 4/20 (20%)
C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
C2H2 Zn finger 129..149 CDD:275368 6/24 (25%)
C2H2 Zn finger 431..451 CDD:275368 5/24 (21%)
zf-H2C2_2 445..468 CDD:372612 7/31 (23%)
C2H2 Zn finger 459..479 CDD:275368 6/19 (32%)
C2H2 Zn finger 487..506 CDD:275368 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.