DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42564 and CLEC18B

DIOPT Version :10

Sequence 1:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_047302585.1 Gene:CLEC18B / 497190 HGNCID:33849 Length:481 Species:Homo sapiens


Alignment Length:209 Identity:48/209 - (22%)
Similarity:70/209 - (33%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ISPKVERFLLRRFNELRDSVAKGGFNGLSPASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTK 153
            ::.|....||...|.||..|.       .||:.|..|.|:..||.||:.....|.:     ....
Human    43 LNRKESFLLLSLHNRLRSWVQ-------PPAADMRRLDWSDSLAQLAQARAALCGI-----PTPS 95

  Fly   154 FTQNAGQTVGYRGIKGKLPELEDILRDIIGVWLREKSRTSMVNIMKYVEQE-------SQSPKYN 211
            ......:|:........||.......:::.:|..|..|.|      :...|       :...:.:
Human    96 LASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYS------HAAGECARNATCTHYTQVS 154

  Fly   212 FLQIVLENAESVGCAIVQQSRH----GWIQT---FFACNY---GHAPVVGSPVYEPGKKAAESCK 266
            .||:|...:..:||     .||    |  ||   .|.|.|   |:..|.|..:. |.||.|    
Human   155 VLQLVWATSSQLGC-----GRHLCSAG--QTAIEAFVCAYSPGGNWEVNGKTII-PYKKGA---- 207

  Fly   267 TGANPKYAHLCAES 280
                  :..||..|
Human   208 ------WCSLCTAS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42564NP_649651.2 CAP_euk 95..245 CDD:349399 37/166 (22%)
CLEC18BXP_047302585.1 CAP_euk 50..188 CDD:349399 36/162 (22%)
EGF_CA 235..266 CDD:238011
CLECT 315..439 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.