DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42564 and CLEC18C

DIOPT Version :10

Sequence 1:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:199 Identity:44/199 - (22%)
Similarity:66/199 - (33%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ISPKVERFLLRRFNELRDSVAKGGFNGLSPASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTK 153
            ::.|....||...|.||..|.       .||:.|..|.|:..||.||:.....|.:     ....
Human    43 LNRKESFLLLSLHNRLRSWVQ-------PPAADMRRLDWSDSLAQLAQARAALCGI-----PTPS 95

  Fly   154 FTQNAGQTVGYRGIKGKLPELEDILRDIIGVWLREKSRTSMVNIMKYVEQESQSPKYNFLQIVLE 218
            ......:|:........||.......:::.:|..|..|.|..    ..|....:...::.|:|..
Human    96 LASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHA----AGECARNATCTHYTQLVWA 156

  Fly   219 NAESVGCAIVQQSRHGWIQTFFACNYGHAPVVG-----SP--VYEPGKKAAESCKTGANPKYAHL 276
            .:..:||     .||       .|:.|.|.:..     ||  .:|...|.....|.||   :..|
Human   157 TSSQLGC-----GRH-------LCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGA---WCSL 206

  Fly   277 CAES 280
            |..|
Human   207 CTAS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42564NP_649651.2 CAP_euk 95..245 CDD:349399 31/149 (21%)
CLEC18CNP_775890.2 CAP_euk 50..183 CDD:349399 33/160 (21%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.