DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRAT and CPT2

DIOPT Version :9

Sequence 1:NP_001287195.1 Gene:CRAT / 40787 FlyBaseID:FBgn0037440 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_000089.1 Gene:CPT2 / 1376 HGNCID:2330 Length:658 Species:Homo sapiens


Alignment Length:653 Identity:168/653 - (25%)
Similarity:313/653 - (47%) Gaps:85/653 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IAKKVLPASSYSTVQKTIPLEQPNLLKYHVLPLEETLNRFMTTVEPLLTPEEFQRQKGITSEFLK 114
            :.:.::|...|          |.:|.:..:..||:|:.|:::..:|||...:|::.:.....|..
Human    35 LQRSIVPTMHY----------QDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFEN 89

  Fly   115 KQGREL--QLLLEETGSKEKNWLAHRWLKAAYLTYRDPVTVFVSPGMTF---PKQNFRD--SRAF 172
            ..|:||  ||:..:..:|..::::..|.. .||:.||.|.:..:|.|.|   ||..:.|  :|| 
Human    90 GIGKELHEQLVALDKQNKHTSYISGPWFD-MYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRA- 152

  Fly   173 VDYTARVI-------YGLGEFNDMVHANK--------------IP-------IVKMGKNELDNSQ 209
            .:.|...|       .||.| .::.|.|.              :|       ...:....||.||
Human   153 TNMTVSAIRFLKTLRAGLLE-PEVFHLNPAKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQ 216

  Fly   210 FGKVFGTCRIPRRGTDEIVYNPDSDYVVVIYKNHFYQLKIYSKEGKLIAAPCLAAQLENIVLKET 274
            :.::|.:.|:|:...||:..:..:.:::|:.|.:||...:..::|.:::...:.|.|:.|:...:
Human   217 YFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSS 281

  Fly   275 QV-GVPYGILTTDSRDNWAEAYEYLVETPGNRDALKTIQGALFTVSLDEGTILKEGEETDELILS 338
            .. ..|...||:::||.|||..:.|:.: ||.::|:.:..|:|.:.||:..|    ::...|..:
Human   282 PAPEFPLAYLTSENRDIWAELRQKLMSS-GNEESLRKVDSAVFCLCLDDFPI----KDLVHLSHN 341

  Fly   339 LIHGSGSKINSGNRWMDKTIQLVVNPNGNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPSF---G 400
            ::||.|:     |||.||:..|::..:|:....:|||..:|..:....:.|.:...:.|:.   .
Human   342 MLHGDGT-----NRWFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQS 401

  Fly   401 QSGSQD-FAPAQKIQFSSSNKSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDS 464
            |..:.| ....||:.|..:: :|:..:..|:|..|.....|.:..::|...||:|:|||:|.||:
Human   402 QPATTDSTVTVQKLNFELTD-ALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDA 465

  Fly   465 FVQMALQLAFYKMHSEPPAQYESAHLRIFDGGRTETIRSCSNESLAFSRA-MQDPNVTDQERAAK 528
            ..|:|.|:||.:.:.:..|.|||.....|..|||||||..|..:...|.| :::|:   :..|.:
Human   466 VAQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPS---RHSAGE 527

  Fly   529 LREAVVS----HQTYAKLALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQV 589
            |::.:|.    |....|.|..|:|.||||..|:.:|......:||.:..|.:.:.:|..:|||.:
Human   528 LQQMMVECSKYHGQLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTL 592

  Fly   590 ATKYDAFMGYGPATDDGYACCYNPRDNDIILAISAWRHCPITDH-----LKFVKTLEQSFFEMKN 649
            ::......|:.|...||:...|...||        |..|.::.:     .:|::.:|::..:|.:
Human   593 SSPAVNLGGFAPVVSDGFGVGYAVHDN--------WIGCNVSSYPGRNAREFLQCVEKALEDMFD 649

  Fly   650 VLE 652
            .||
Human   650 ALE 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRATNP_001287195.1 Carn_acyltransf 74..648 CDD:279140 162/623 (26%)
CPT2NP_000089.1 Carn_acyltransf 49..648 CDD:279140 162/623 (26%)
Coenzyme A binding. /evidence=ECO:0000250 452..464 7/11 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167256at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.