DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRAT and LOC101884918

DIOPT Version :9

Sequence 1:NP_001287195.1 Gene:CRAT / 40787 FlyBaseID:FBgn0037440 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_005173070.2 Gene:LOC101884918 / 101884918 -ID:- Length:123 Species:Danio rerio


Alignment Length:112 Identity:41/112 - (36%)
Similarity:66/112 - (58%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 ALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQVATKYDAFMGYGPATDDGY 607
            |:.|.|:|.|||||:.||.:.....|:.|....:..|:||.:|||||.|:.:.|..|||...|||
Zfish     9 AVTGNGMDNHLLGLREMARQMEMQTPDIFSDETYKISNHFILSTSQVPTEMEMFCCYGPVVPDGY 73

  Fly   608 ACCYNPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEKN 654
            ..||||:.:.|:.::|::|....|...:..:.|:.:..:||::..|:
Zfish    74 GVCYNPQSDHIVFSVSSFRENKETCSDRLAEELQVALLDMKDLCMKH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRATNP_001287195.1 Carn_acyltransf 74..648 CDD:279140 38/104 (37%)
LOC101884918XP_005173070.2 Carn_acyltransf <8..114 CDD:279140 38/104 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167256at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.