DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRAT and LOC100492865

DIOPT Version :9

Sequence 1:NP_001287195.1 Gene:CRAT / 40787 FlyBaseID:FBgn0037440 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_017948826.2 Gene:LOC100492865 / 100492865 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:319 Identity:107/319 - (33%)
Similarity:161/319 - (50%) Gaps:28/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 SGNRWMDKTIQLVVNPNGNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPSFGQSG------SQDF 407
            |.:||.|||:..||..||.:|....||.|:...:..:.:||:...|.:..:.:.|      :.:.
 Frog     8 SASRWFDKTMSFVVFKNGKMGMNVGHSWADAPIVGHLWEYVMATDKMELGYNEDGHCKGDVNGNI 72

  Fly   408 APAQKIQF---SSSNKSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMA 469
            .|..::|:   ......:|:||.||:    .|||.:......|:.|||..|||.|..||:|||::
 Frog    73 PPPSRLQWDIPEECQNVVEESLTVAK----ALADDVDFHSFPFDSFGKGLIKKSRTSPDAFVQLS 133

  Fly   470 LQLAFYKMHSEPPAQYESAHLRIFDGGRTETIRSCSNESLAFSRAMQDPNVTDQERAAKLREAVV 534
            ||||.|:...:....||::..|:|..|||||:|||:.||..|..||.||:.|:::|....:||..
 Frog   134 LQLAHYRDKGKFCLTYEASMTRLFREGRTETVRSCTIESCDFVLAMSDPSQTNEKRLQLFKEAAE 198

  Fly   535 SHQTYAKLALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQVAT---KYDAF 596
            .||...:||:.|.|:||||..|.:::.......| |.|.   |.|..:|..|.|...   :.:.|
 Frog   199 KHQQMYRLAMTGSGIDRHLFCLYVVSKYLGVDSP-FLKE---VLSEPWRXQTPQQQVHLFQLEKF 259

  Fly   597 M-------GYGPATDDGYACCY-NPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEM 647
            .       |:||..||||...| ...:|.|...||:....|.||..:|.|.::|:..::
 Frog   260 PENVSSGGGFGPVADDGYGVSYIIVGENLINFHISSKFSSPETDSHRFGKHIKQAMIDI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRATNP_001287195.1 Carn_acyltransf 74..648 CDD:279140 107/319 (34%)
LOC100492865XP_017948826.2 Carn_acyltransf <10..318 CDD:395612 106/315 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.