DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stx12 and Syx7

DIOPT Version :9

Sequence 1:NP_998883.1 Gene:stx12 / 407856 XenbaseID:XB-GENE-974475 Length:267 Species:Xenopus tropicalis
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:270 Identity:89/270 - (32%)
Similarity:155/270 - (57%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


 Frog    13 DFNSIIQTCSGNVQRITNNTAQIRTLLNQLGTSQDSTKLQQNLQQIQHSTNVLAKETNTYLKDLA 77
            ||..:.|..:.::|::..|.:.::.::|||.|.|||.:|::.|.||...||.|..:||..:.:  
  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINE-- 84

 Frog    78 SVPTPLSPAEQRQQKLQKERLMNDFSAALNHFQAIQRQVSTKEKETVARA--------------R 128
                 :...::|..|:|::||:::|:|||..||::||:.:..||..:.:|              |
  Fly    85 -----VDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSSR 144

 Frog   129 AGSRLSADERQKEEQLVS---FDNNEDWNQLQSQDEEFAVTEEDLELIKERESAIQKLEADILDV 190
            .||..|:..:|.......   |:...:..|:|:|.||    :.||:.::|:|..|::||.:|:.|
  Fly   145 TGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEE----QADLQALEEQEQVIRELENNIVGV 205

 Frog   191 NQIFKDLAVMIHDQGEMIDSIEANVESAEVHVERGTEQLQRAAYYQKKSRKKICILV--LALAIA 253
            |:|:|.|..::::||..:||||:.||...:.|.:|||.|::|:.|:.|.|||..|||  |:..:.
  Fly   206 NEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAVLL 270

 Frog   254 AVILGLIIYF 263
            |:||.|:..|
  Fly   271 AIILILVFQF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stx12NP_998883.1 Syntaxin_2 22..124 CDD:373109 33/101 (33%)
SNARE_syntaxin12 173..239 CDD:277229 26/65 (40%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 33/102 (32%)
COG5325 <97..276 CDD:227635 63/182 (35%)
SNARE 188..247 CDD:304603 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8900
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4205
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - otm47591
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.