DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and Rxrg

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_038947050.1 Gene:Rxrg / 83574 RGDID:620046 Length:464 Species:Rattus norvegicus


Alignment Length:316 Identity:91/316 - (28%)
Similarity:136/316 - (43%) Gaps:57/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            ||:|||:||||||||..|:||..||||::|:...|.| ....:|::||.:||.|..||:|:||.:
  Rat   139 CAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTC-RDNKDCLIDKRQRNRCQYCRYQKCLVM 202

  Fly    72 GMNAAAVQEERGPRNQQVA-----LYRTGRRQAP-----PSQAAPSP---------------TPH 111
            ||...|||||| .|:::.|     ...||....|     .::.|..|               .|.
  Rat   203 GMKREAVQEER-QRSRERAESEAECASTGHEDMPVERILEAELAVEPKTESYGDMSVESSTNDPV 266

  Fly   112 SQALHFQILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDI-------- 168
            :...|  ...:.|.|.:..||....|:.|....|..:.:..|:|:.:...||.|:.:        
  Rat   267 TNICH--AADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLAT 329

  Fly   169 -------SAMIDGCG----DEQLKRLICEAHQLRADVLELNFMESLILCR---KELAINAEYAVI 219
                   ||...|.|    ...|..|:.:...:|.|..||..:.:::|..   |.|:..:|...:
  Rat   330 GLHVHRSSAHSAGVGSIFDSRVLTELVSKMKDMRMDKSELGCLRAIVLFNPDAKGLSNPSEVETL 394

  Fly   220 LGSHSKAALISLARYTLQQ--SNYLRFGQLLLGLRQLCLRRFDCALSCMFRSVVRD 273
                .:....:|..||.|:  ....||.:|||.|..|......|.....|..::.|
  Rat   395 ----REKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGD 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 43/80 (54%)
RxrgXP_038947050.1 Nuc_recep-AF1 25..133 CDD:403126
NR_DBD_RXR 137..213 CDD:143514 40/74 (54%)
NR_LBD_RXR_like 233..442 CDD:132741 44/214 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.