DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and NR2C2

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_011532360.1 Gene:NR2C2 / 7182 HGNCID:7972 Length:648 Species:Homo sapiens


Alignment Length:99 Identity:43/99 - (43%)
Similarity:62/99 - (62%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||::||:|||...|:||..|||||||:..:|:|.: ..:|:::|..||.|..||.::||.:
Human   169 CVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRS-NQDCIINKHHRNRCQFCRLKKCLEM 232

  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAA 105
            ||...:||.||.|.:.|        |:.|.:.||
Human   233 GMKMESVQSERKPFDVQ--------REKPSNCAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 38/80 (48%)
NR2C2XP_011532360.1 NR_DBD_TR2_like 164..250 CDD:143525 39/89 (44%)
NR_LBD_TR2_like 413..634 CDD:132750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.