DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and NR2F1

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_005645.1 Gene:NR2F1 / 7025 HGNCID:7975 Length:423 Species:Homo sapiens


Alignment Length:301 Identity:96/301 - (31%)
Similarity:137/301 - (45%) Gaps:62/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            |.||||:|||||||...|:||..||||||||..:|.|.| ..||.:|:..||.|..||.::||.|
Human    86 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRA-NRNCPIDQHHRNQCQYCRLKKCLKV 149

  Fly    72 GMNAAAVQEERGPRNQ----QVAL----------YRTGRRQAPPSQAAPSPTPH--SQALH---- 116
            ||...|||..|.|..|    |.||          |.:|.... ..:|.|.||..  ||.:.    
Human   150 GMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISL-LLRAEPYPTSRYGSQCMQPNNI 213

  Fly   117 ------FQILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWS--LDISAMID 173
                  .::.|::|.:.:..|:....|..|....|.::.::.|||:|||.|:..|  |.::.::.
Human   214 MGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLA 278

  Fly   174 GCG---------------------DEQLKRLICEAHQLRADVLELNFMESLILCRKELA--INAE 215
            ..|                     .||:::|    ..|..|..|.:.:::::|...:..  .:|.
Human   279 AAGLHASPMSADRVVAFMDHIRIFQEQVEKL----KALHVDSAEYSCLKAIVLFTSDACGLSDAA 339

  Fly   216 YAVILGSHSKAALISLAR--YTLQQSNYLRFGQLLLGLRQL 254
            :...|...|:.||....|  |..|.|   |||:|||.|..|
Human   340 HIESLQEKSQCALEEYVRSQYPNQPS---RFGKLLLRLPSL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 45/84 (54%)
NR2F1NP_005645.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
NR_DBD_COUP_TF 86..158 CDD:143516 41/72 (57%)
NR_LBD_COUP-TF 184..419 CDD:132746 48/202 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.