DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and RXRB

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001257330.1 Gene:RXRB / 6257 HGNCID:10478 Length:537 Species:Homo sapiens


Alignment Length:325 Identity:95/325 - (29%)
Similarity:141/325 - (43%) Gaps:68/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71
            ||:|||:||||||||..|:||..||||::|:..:|:| ....:|.|||.:||.|..||:|:|||.
Human   205 CAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC-RDNKDCTVDKRQRNRCQYCRYQKCLAT 268

  Fly    72 GMNAAAVQEER---------------GPRNQ--------QVALYRTGRR--QAPPSQAAPSPTPH 111
            ||...||||||               .|...        ::|:.:...:  :.|........:|:
Human   269 GMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPN 333

  Fly   112 SQALHF-QILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDI------- 168
            ....:. |...:.|.|.:..||....|:.|....|..:.:..|:|:.:...||.|:|:       
Human   334 DPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLA 398

  Fly   169 --------SAMIDGCG---DEQLKR----LICEAHQLRADVLELNFMESLILCR---KELAINAE 215
                    ||...|.|   |..|.|    |:.:...:|.|..||..:.::||..   |.|:..:|
Human   399 TGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSE 463

  Fly   216 YAVI-------LGSHSKAALISLARYTLQQSNYLRFGQLLLGLRQLCLRRFDCALSCMFRSVVRD 273
            ..|:       |.::.|      .:|..||.   ||.:|||.|..|......|.....|..::.|
Human   464 VEVLREKVYASLETYCK------QKYPEQQG---RFAKLLLRLPALRSIGLKCLEHLFFFKLIGD 519

  Fly   274  273
            Human   520  519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 45/103 (44%)
RXRBNP_001257330.1 Modulating. /evidence=ECO:0000250 1..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..181
NR_DBD_RXR 204..279 CDD:143514 42/74 (57%)
Hinge 271..295 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..299 5/22 (23%)
NR_LBD_RXR_like 298..515 CDD:132741 49/225 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..336 2/22 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.