DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr83 and hnf4g

DIOPT Version :9

Sequence 1:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_021325864.1 Gene:hnf4g / 557104 ZFINID:ZDB-GENE-060929-100 Length:459 Species:Danio rerio


Alignment Length:309 Identity:87/309 - (28%)
Similarity:131/309 - (42%) Gaps:81/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SACAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCL 69
            |.||:|||:::|||||.|.||||..||:||:|:...|:| .....|||||.:||.|..||..:|.
Zfish    60 SNCAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSC-RFNRQCVVDKDKRNQCRFCRLHKCF 123

  Fly    70 AVGMNAAAVQEERGPRNQQVALYRTGRRQAPPSQAAPSPTPHSQALHFQILAQILVTC---LRQA 131
            ..||...|||.||    .::    :.||....|...|   |.:...|.:.|:|..:|.   :..|
Zfish   124 RAGMKKEAVQNER----DRI----SSRRNIQDSHDLP---PITALAHAEALSQQQITAASPMGPA 177

  Fly   132 KANEQ--FALLDRCQ---QDAIFQVVWS-------------EIFVLRA---SHWSL--------- 166
            ..:|:  ..:.|.|:   |..:..|.|:             ::.:|||   .|..|         
Zfish   178 DVSEKKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRSMSY 242

  Fly   167 -DISAMIDGC--------------GDEQLKRLICEAHQLRADVLELNFMESLILCRKELAINAEY 216
             |:..:.:||              .:..|..|:.....::.|..|...:::::....:       
Zfish   243 KDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPD------- 300

  Fly   217 AVILGSHSKAALISLARYTLQQS--NYL---------RFGQLLLGLRQL 254
            |..|...||   |...||.:|.|  :|:         |||:|||.|..|
Zfish   301 AKSLRDPSK---IKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 40/80 (50%)
hnf4gXP_021325864.1 NR_DBD_HNF4A 62..137 CDD:143518 40/79 (51%)
NR_LBD_HNF4_like 154..375 CDD:132729 41/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.